KEGG   Caldicellulosiruptor obsidiansis: COB47_0732Help
Entry
COB47_0732        CDS       T01293                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cob00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    COB47_0732
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    COB47_0732
Enzymes [BR:cob01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     COB47_0732
Two-component system [BR:cob02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   COB47_0732
Bacterial motility proteins [BR:cob02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    COB47_0732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
851520..852560
Genome map
AA seq 346 aa AA seqDB search
MYKVLVVDDSAFMRQLIKSFLESTGKFVVTVAQTPLIALDKVRKFKFDVITIDYEMPYMN
GVELIKKIKEITDTKILMVSAYTRPGAYTTFEALSAGAFDYILKPSSDEEIEEFKYELIK
KLTAVCEEFKVDDASKTKEDTTAIEGKILLEESIIERARLAKVIGIGISTGGPPVLEKMF
KSLKKDFPIPILVVQHMPPNFTKPFADRLASITSKCIKEASDREEIKSGCIYIAKGGYHL
AVEEINGKLCTRVLDLEKIKSHKPSADILFSSIAEVCEKASIGIIMTGMGYDGSDGILEM
RKKGALTIAQDEKSCVVFGMPKAAIEKGAIELILSPDQIVELLNRV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaggtattggttgttgatgattcagcgtttatgagacagctcataaaatcgttt
ttagagagtactggaaaatttgttgtaacagttgctcaaactcctctcattgcccttgac
aaggttcgcaagttcaagtttgatgtgataacaatcgactatgagatgccatatatgaac
ggtgttgaactgataaaaaaaataaaagaaataacagatacaaagattttgatggtaagt
gcatacacccgtccgggagcttacactacatttgaggcattgtcagcaggtgctttcgat
tatattttaaagccatcttctgatgaggaaattgaagagttcaagtatgaactaataaaa
aaacttactgctgtgtgtgaggaattcaaagtagatgatgcttcaaagactaaagaggat
acaactgcaattgaaggcaagattttactagaagaaagtattattgaaagggcaagatta
gcaaaggttatcgggataggtatctccacaggtggtccgcctgttttagaaaagatgttt
aagtctttaaagaaagattttccaattccaattcttgttgttcagcacatgccgccaaac
tttacaaaaccatttgcagacagacttgcttcaattacttcaaaatgtataaaagaagct
tctgacagagaagaaataaaaagtggctgcatttatattgcaaaaggtggatatcactta
gcagttgaagagataaatgggaaactttgtaccagagtacttgatcttgagaaaataaag
agtcacaaaccttcggcagatattcttttcagttcaatagcagaagtctgtgaaaaagct
tctataggaattataatgacaggaatgggatacgatggtagtgatgggattttggagatg
agaaaaaaaggagcgctcacaattgcgcaggatgaaaaaagttgtgtggtgtttgggatg
ccaaaagcagccattgaaaaaggagcaatagagcttattttaagtcctgaccaaattgtt
gagcttttgaatagagtatga

DBGET integrated database retrieval system