KEGG   Caldicellulosiruptor obsidiansis: COB47_0758Help
Entry
COB47_0758        CDS       T01293                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COB47_0758
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    COB47_0758
Enzymes [BR:cob01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     COB47_0758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
882270..884030
Genome map
AA seq 586 aa AA seqDB search
MIGKDFIRVLYIDLTNKKADIQEREDLYKYLGGAGVAAKLLEENMKKGVDPLHESQPLII
SIGPLSTIFPVVTKAVATFVSPHTGEYGESHAGGRLAMAIRNAGYDAIVITGKAQKPTYL
VITDKNIEFKDARAMWGLDIEETGRVIREREPGPGKRSIIRIGRAGENLVTYSCVNVDTY
RHFGRLGIGAVFGSKNLKAMMIMGEEDLPISNLKEYFKTYQEIYKKVTQTDAMAKYHELG
TPMNIKVLNSISSLPTKNLLQSTFEHADDISGETFAEKNLVRKVSCVGCPIGCIHIGQFR
REFDKGYEYESIAVSYDHELIYALGSLLGIKTTDEVLQIIDEVELAGLDAISTGVVLAWA
TEALKKGLISREDTLADLEFGNTMEYVKAIDNIADRVNEFYYTIGKGLKEAVKKYGGEEF
ALLYGGNEMAGYHTGYAFALGQTVGARHSHLDNAGYSYDQSAKELKDEEIIDYVINEEKE
RAVLTSLCICLFARKVYDRSTILKALNAVGINWTNDDLTRLANDVFFTKLKIKKELGYSL
ENYKFPKRIFETPTMWGKMDEERLNRLLKMYIERVEKEYEDWSRGK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgataggcaaggactttataagagtgctttatattgaccttacaaacaaaaaagcagat
attcaagaaagggaggatctttacaaatacttaggcggagcaggtgttgcagcaaaactt
ttagaggaaaatatgaaaaaaggtgttgaccctttgcatgaaagccagcctctcattata
tctataggacctctttcaactatctttcctgttgtgacaaaagctgttgctacttttgtc
tcaccccatacaggagaatacggggaaagtcatgcaggtggcagacttgcaatggctata
agaaatgcagggtatgatgcaatagttataacaggaaaagctcaaaagcccacatacctt
gtcattacagataagaatattgaatttaaagatgcaagagctatgtggggacttgacata
gaggagacaggaagggttataagagaaagagagccaggtccagggaaaagaagtataatc
agaattggcagggcaggcgaaaaccttgtaacatactcttgtgtcaacgttgatacttac
agacattttggaaggcttggcataggagcagtctttggaagcaaaaacctcaaagcgatg
atgataatgggcgaagaggatttgcctatttcgaatttaaaagagtactttaagacttat
caggagatatacaaaaaagttacacagacagatgcaatggcgaagtatcatgagcttggg
acacctatgaacatcaaagtgctaaacagcataagttctcttccaactaagaatttactt
cagtctacatttgagcatgcggacgatatctcaggtgagacgtttgccgaaaagaacctg
gtcagaaaggtttcgtgtgttggctgtcccattggatgcatccatatagggcagttcaga
cgcgagtttgacaagggatatgagtatgagtctattgctgtatcgtatgaccatgaactt
atatatgctttaggtagtcttttaggaataaaaacaactgatgaggtccttcagattatt
gatgaggtagaacttgcaggacttgatgctatctcaacaggtgttgtattggcatgggca
acagaagcactcaaaaaaggtcttatctcaagagaagacactcttgctgaccttgagttt
ggcaacaccatggagtatgtaaaagcaattgacaatattgcagacagggtaaacgagttt
tactacacaattggcaaaggtctcaaagaggctgtgaaaaaatatggaggagaagagttt
gcacttttgtatggtggcaatgagatggcaggatatcatacaggctatgcatttgcgctt
ggtcaaacagttggtgcaaggcattctcacttagacaatgcaggttactcttatgaccag
agcgcaaaagaattaaaagatgaggaaataatagattatgtgattaatgaagagaaggaa
agagcagtgctcacatcgctgtgcatatgtctatttgcacgaaaggtgtatgacaggtca
actatcttgaaagcattaaatgcggttggtataaactggactaatgatgaccttacacga
cttgcaaatgacgtattttttactaaactaaaaatcaaaaaggagcttggatattcactt
gaaaattataaatttccgaagagaatatttgaaacacctacaatgtggggaaagatggat
gaagagaggttaaataggcttttgaagatgtatatcgagagggtggaaaaagaatatgaa
gattggagtagaggtaaatag

DBGET integrated database retrieval system