KEGG   Caldicellulosiruptor obsidiansis: COB47_0794Help
Entry
COB47_0794        CDS       T01293                                 

Definition
glycoside hydrolase family 2
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    COB47_0794
  Lipid metabolism
   00600 Sphingolipid metabolism
    COB47_0794
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    COB47_0794
Enzymes [BR:cob01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     COB47_0794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
920386..922818
Genome map
AA seq 810 aa AA seqDB search
MQKINLDRSWEYLELGFANVLSLTNSEYEWKKVDLPHDAVIEKERSEANPSGAGEGYTAG
CSLYYKKELFLNEQWQGKNLILEFEGIMGIAEVFINGRLVAKHFNGYTSFLIDITKHVKF
DDKNIIIVRVENTHKPSSRWYAGCGIYRHVWLHIGGKVYIKPWHLHVQTREIENQTAKLE
VKAVILNSVNEEIEGVIKFDVFSKEEKLVLSSEEKFLIGENEEEVISKTLELKPFKYWDV
EDPYLYKIQATIICYESVEDSASTLFGIRTISVDPKEGFKLNGKPLKLKGGCIHHDNGPL
GSVSFDRAEEKKVELLKASGFNALRLAHNPFAPAFLDACDRLGMLVIEEFFDVWHAGKVS
FDYHLFFDKYWEEDLESTIMRDYNHPSIIMWSIGNEITWGVGVDVDDHSSYSIYSWCERL
AKKVKSLDSSRLVTAALCAIPDDYKRLFAIIEKGNYVIRMLKQEADVIEDKWGEFSEKFS
KFLDVVGYNYKVDRYRYDRYKYPNRIICGTETYPYTLFKNWKETMENSNVIGDFVWTAID
YLGEAGLGRVSIEVDDLKSFCGSYPWFLANCGDIDICGEKRPQSYYRDVVWGNRKDPYIV
ILPPQVYGKKLYFKPWAWEPVERSHTFPGCEGMPIEIHIYANADEVELFVNGRSLGRKEA
DVSTEFKAVYDTIYEPGVIEAVAYKDGKEIGRDKIETTDEPAALKLVPDREVISSCYGDL
CYIKIIAVDKNGREVVFADNTIVVEVEGVGELVALGTADPLSGEPFVSRKRKLYKGRALA
IVKSIGKKGEFELKAWAEGLDGAQVFVKCI
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaaataaatttagacaggtcatgggaatatcttgagcttggttttgcaaacgtg
ctaagcttaacaaattcagaatatgagtggaaaaaggtagatctgccacatgatgctgta
attgaaaaggaaagaagtgaggccaatccctcaggtgctggtgaagggtatactgcggga
tgcagtttgtattacaaaaaggaattgttcttgaatgagcaatggcaaggcaaaaactta
atacttgagtttgaaggaattatgggtatagccgaggtttttataaatggtagattagtt
gcaaaacatttcaatggatacacaagttttctaattgatataacaaagcatgtcaagttt
gatgataagaacattattattgtgcgtgtggaaaatactcataagccaagctcaaggtgg
tacgcaggttgtggtatatacaggcatgtgtggctacacatcggtggcaaggtatatata
aaaccgtggcatttgcatgttcaaaccagagaaattgaaaaccaaacggcaaagttagaa
gtaaaagctgttattctcaacagtgtgaatgaagaaattgaaggagtaataaagtttgat
gtattttcaaaagaggaaaaattagtgctcagcagtgaagagaagtttttgattggtgaa
aatgaagaagaggtaatttccaaaaccttagaactaaaaccatttaaatattgggatgta
gaagatccatatctttataaaattcaagcaactattatttgttatgagagtgtagaagat
agtgcttctacattgtttggtattcgaacaatttcagttgatccaaaagaaggatttaaa
ttaaatggtaaaccattaaaattaaaaggtggctgtattcatcatgacaacggaccactt
ggaagtgtaagtttcgatagagcagaagagaaaaaagtagaacttttaaaagcttctgga
ttcaatgcgttaagacttgcacataatccatttgctccagcgtttttggatgcttgtgat
agattggggatgcttgtgatagaagaattttttgatgtatggcatgctggcaaggttagc
tttgactaccatctattttttgacaagtactgggaagaagatttggaatccaccataatg
agggactataatcacccttcgataataatgtggtcaataggaaacgagattacatgggga
gttggagttgatgttgatgaccatagcagctattccatctacagctggtgtgagcgatta
gctaaaaaagtaaagagtttggattcatcaaggctggtaacagcggcgctgtgcgcaatc
ccggatgattataaaaggctttttgccataattgaaaaaggtaactatgtaattagaatg
cttaaacaagaagctgatgttattgaagataaatggggcgagttctcagaaaagttctca
aagtttttagatgttgttggttataattataaagtagatagatatagatatgatagatac
aaatatcctaaccgaataatttgtggtaccgaaacttatccatatactcttttcaaaaac
tggaaggaaacaatggaaaattcaaatgtaataggtgattttgtatggacggctattgat
tatttgggcgaagcaggtcttggtagggtaagtattgaagtagatgatcttaaatctttc
tgcgggtcttatccatggtttttagcaaattgtggagatattgatatttgtggtgaaaaa
cgtcctcaatcgtattatagagatgttgtttggggaaataggaaagatccatatattgta
atacttcctccacaagtgtatggcaaaaaactatactttaaaccctgggcatgggagcct
gttgaaagaagccacacttttcctggatgtgaagggatgccaatagagatacatatttat
gcaaatgcagatgaggttgagttgtttgtaaatggcagaagtttgggaagaaaagaagct
gatgtttccactgagtttaaagcagtttatgacacgatttatgaaccaggagtgatagaa
gctgtagcatacaaagatggtaaagagattggcagagacaaaatagagacaacagatgag
cccgcagccttaaaactggtacctgacagagaagttatatcctcttgttatggtgatttg
tgctacataaagataatagcagttgataagaatgggagagaggttgtttttgcggataac
acaatagttgtagaagttgaaggtgttggcgaacttgttgctttgggaactgctgatcct
ttatcgggagaaccatttgttagccgaaagagaaaactttataaaggacgagcactggca
atagtaaagagtattggcaaaaaaggagaatttgaattgaaagcttgggcagaaggattg
gatggtgctcaagtttttgtaaaatgcatctaa

DBGET integrated database retrieval system