KEGG   Caldicellulosiruptor obsidiansis: COB47_0808Help
Entry
COB47_0808        CDS       T01293                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  
pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COB47_0808
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COB47_0808
   00020 Citrate cycle (TCA cycle)
    COB47_0808
   00620 Pyruvate metabolism
    COB47_0808
   00640 Propanoate metabolism
    COB47_0808
   00650 Butanoate metabolism
    COB47_0808
  Energy metabolism
   00680 Methane metabolism
    COB47_0808
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    COB47_0808
Enzymes [BR:cob01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     COB47_0808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
938468..938767
Genome map
AA seq 99 aa AA seqDB search
MRKMKITEDVTWKEITPAGVIIDPGNAEDFKTGDWRTMRPVWHEDKCKQCLFCFYVCPDS
SIKVENGKMVGVDYDHCKGCGVCTEVCPFKAFDFVEEKK
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagatgaaaataacagaagatgttacatggaaggaaataacaccggcaggtgta
atcattgacccgggtaatgcagaggactttaaaacaggcgattggagaacaatgagacct
gtttggcatgaagataagtgcaagcagtgtttgttctgcttctatgtatgtccagattca
tcaataaaggttgaaaatgggaagatggtcggagttgactatgaccactgtaaaggttgc
ggggtttgtacagaggtttgtccatttaaggcttttgactttgtagaggagaagaaataa

DBGET integrated database retrieval system