KEGG   Caldicellulosiruptor obsidiansis: COB47_0808Help
Entry
COB47_0808        CDS       T01293                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
cob00010  Glycolysis / Gluconeogenesis
cob00020  Citrate cycle (TCA cycle)
cob00620  Pyruvate metabolism
cob00633  Nitrotoluene degradation
cob00640  Propanoate metabolism
cob00650  Butanoate metabolism
cob00680  Methane metabolism
cob01100  Metabolic pathways
cob01120  Microbial metabolism in diverse environments
cob01130  Biosynthesis of antibiotics
cob01200  Carbon metabolism
Module
cob_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COB47_0808
   00020 Citrate cycle (TCA cycle)
    COB47_0808
   00620 Pyruvate metabolism
    COB47_0808
   00640 Propanoate metabolism
    COB47_0808
   00650 Butanoate metabolism
    COB47_0808
  Energy metabolism
   00680 Methane metabolism
    COB47_0808
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    COB47_0808
Enzymes [BR:cob01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     COB47_0808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_2 Fer4_7 Fer4_10 Fer4_16 Fer4_9 Fer4_4 Fer4_13 Fer4_15 Fer4_3 Fer4_17
Motif
Other DBs
NCBI-ProteinID: ADL42120
UniProt: D9TJD8
Position
938468..938767
Genome map
AA seq 99 aa AA seqDB search
MRKMKITEDVTWKEITPAGVIIDPGNAEDFKTGDWRTMRPVWHEDKCKQCLFCFYVCPDS
SIKVENGKMVGVDYDHCKGCGVCTEVCPFKAFDFVEEKK
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagatgaaaataacagaagatgttacatggaaggaaataacaccggcaggtgta
atcattgacccgggtaatgcagaggactttaaaacaggcgattggagaacaatgagacct
gtttggcatgaagataagtgcaagcagtgtttgttctgcttctatgtatgtccagattca
tcaataaaggttgaaaatgggaagatggtcggagttgactatgaccactgtaaaggttgc
ggggtttgtacagaggtttgtccatttaaggcttttgactttgtagaggagaagaaataa

DBGET integrated database retrieval system