KEGG   Caldicellulosiruptor obsidiansis: COB47_0809Help
Entry
COB47_0809        CDS       T01293                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
cob00010  Glycolysis / Gluconeogenesis
cob00020  Citrate cycle (TCA cycle)
cob00620  Pyruvate metabolism
cob00633  Nitrotoluene degradation
cob00640  Propanoate metabolism
cob00650  Butanoate metabolism
cob00680  Methane metabolism
cob01100  Metabolic pathways
cob01120  Microbial metabolism in diverse environments
cob01130  Biosynthesis of antibiotics
cob01200  Carbon metabolism
Module
cob_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COB47_0809
   00020 Citrate cycle (TCA cycle)
    COB47_0809
   00620 Pyruvate metabolism
    COB47_0809
   00640 Propanoate metabolism
    COB47_0809
   00650 Butanoate metabolism
    COB47_0809
  Energy metabolism
   00680 Methane metabolism
    COB47_0809
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    COB47_0809
Enzymes [BR:cob01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     COB47_0809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ADL42121
UniProt: D9TJD9
Position
938803..939984
Genome map
AA seq 393 aa AA seqDB search
MAIRDRLSGNEAIAFAMKQINPDVVAAFPITPSTEVPQYFSQFVANGEVDTEFVAVESEH
SAMSACIGASAAGARTMTATSSQGLALMWEMLYIAASMRLPIVMAVINRALSGPINIHND
HSDSMGARDSGWIQIYCENNQEAYDSLIQAIRIAEHKDVRLPVMVCYDGFITSHAVENIE
LLEDELVKKFVGEYNPEFYLLNEQNPISMGPLDLPPYYFEHKRQQAEAMKNAKKVVLEIA
DEFASLTGRKYGLFESYKLDDAEVAIVVMNSTAGTAKAVVDEYRSKGYKVGLLKPRLFRP
FPVDEIVAALKHLKAVAIMDKVDGFNAAGGPLFTEITSALYGRADGIKAINYIYGLGGRD
VKTDDIAKVYDRLLDIVKTGNVGEVYNYIGVRE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggctattcgtgatagactttctggtaatgaagcgatagcttttgcgatgaaacagata
aaccctgatgttgttgcagcttttccaattacaccttcaactgaagttccacagtatttt
tctcagtttgttgcaaacggggaagtagatacagaatttgttgctgttgagtctgagcac
agcgcaatgagcgcatgtataggtgcatcagcagcaggtgcaaggactatgacagccaca
tcctcacaaggtcttgcacttatgtgggagatgctttatattgcagcgtcaatgagactt
ccaattgttatggcagttataaacagagctctttctggtcctattaatattcacaacgac
cattcagattcaatgggtgcaagagacagtggctggattcagatttactgcgaaaacaac
caggaagcttacgactctttgattcaggcaataagaattgctgagcacaaggatgtaaga
cttcctgtgatggtttgctatgacggatttattacaagccatgctgttgaaaatatagag
cttttagaagatgagcttgtaaagaagtttgtaggtgaatacaatccagagttttatctt
ttgaacgagcaaaacccaatttcaatgggtccattagacttaccgccttactactttgaa
cacaaaagacagcaagctgaagctatgaaaaatgctaaaaaggttgtacttgagattgca
gacgagtttgcttccttgacaggaagaaagtatggtcttttcgaaagctacaagcttgac
gatgcagaggttgcaatagttgtaatgaactccacagcaggaactgcaaaggctgttgtt
gatgagtatagaagcaaaggatacaaggtaggtcttttaaaaccaagactattcagacca
ttccctgttgatgagattgtagcagctcttaagcatttgaaggctgttgctataatggat
aaggttgatggatttaacgcagcgggtggtccacttttcactgagattacaagtgctctt
tatggaagagcagatggtataaaggctatcaactatatatatggtcttggtggaagagac
gttaaaacagatgatattgcaaaggtttatgacagacttcttgacattgtcaagacaggc
aatgttggagaagtttacaactacattggtgtgagagaataa

DBGET integrated database retrieval system