KEGG   Caldicellulosiruptor obsidiansis: COB47_0892Help
Entry
COB47_0892        CDS       T01293                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
cob00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cob01100  Metabolic pathways
cob01110  Biosynthesis of secondary metabolites
cob01130  Biosynthesis of antibiotics
cob01230  Biosynthesis of amino acids
Module
cob_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    COB47_0892
Enzymes [BR:cob01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     COB47_0892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth FMN_dh ThiG QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADL42201
UniProt: D9TJL9
Position
1013407..1014189
Genome map
AA seq 260 aa AA seqDB search
MSVLERILSYKKEEVEKCKNLIPVEKIKKLAVEKIKSQCSENKFKRIFKKEKFCIIGEIK
RASPSEGVISEEANAKAIAKMYEDLGFFAISVLTERFFFKGSEQDLIEVKKAVSLPVLRK
DFIIDIWQLYQTKMIGADAALLITKALSEKQLTIFIKILEILDIVPLVEVENEYEIEKAL
KCGAKLIGINNRNLDDLSVDITKTERLLKYIPKEVAVISESGIKTKEDFEYILMLGVDGC
LIGTSFMKSQNPLEIIGDRI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgcttgagcgtatcttgagctataaaaaagaagaggtagaaaagtgtaaaaat
ctcatacctgttgaaaaaataaaaaaacttgcagttgaaaagattaaaagtcagtgttca
gaaaacaagttcaaaagaatattcaaaaaagaaaaattctgtataattggtgaaataaaa
agagcatcaccttcggagggtgtaatatcagaggaggccaatgcaaaagcaatagcaaag
atgtatgaagatttagggttttttgctatatcagttttgacagaaaggttttttttcaag
ggttcggaacaagacttgattgaagtaaaaaaagctgtatctctgcctgtgctaagaaaa
gactttatcattgatatctggcagctttaccagacaaagatgataggcgcagacgcagct
ttgcttattacgaaagctttgtcagaaaaacagcttacaatattcatcaaaattttggaa
attcttgacatagtaccgcttgttgaggttgaaaatgaatacgaaattgaaaaagctttg
aagtgtggtgcaaaactcataggaatcaacaacagaaacctggatgatttgtcggtggac
ataacaaagacagaaaggcttttgaagtatattccaaaagaagttgctgtgataagcgaa
agcggaattaaaacaaaagaagattttgaatatattcttatgctcggtgttgatggatgt
ttgatagggacatcttttatgaaatcacaaaatccgcttgaaataattggtgataggata
tga

DBGET integrated database retrieval system