KEGG   Caldicellulosiruptor obsidiansis: COB47_0895Help
Entry
COB47_0895        CDS       T01293                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    COB47_0895
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    COB47_0895
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    COB47_0895
Enzymes [BR:cob01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     COB47_0895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1015971..1016741
Genome map
AA seq 256 aa AA seqDB search
MNLIDERFEKLKKEGKKAFIGYVTFGYPSFEETLDYIKLVYSYVDILEIGFPFSDPIADG
EIIQKASRKALSEGVKLNHLFESIEKFKKDKPVVLMLYANTVYKKGIDRFFESSKTCGVD
GVIIPDVSFEESFEFKEVAEKFGIVYIDLVSISSLDRAKMIAKQAKGFLYCVSRKGVTGF
KGQIDDRIFTFLKELKTVTSTPLAVGFGIKSKEDVEKFKDLADGIVIGSAIITKIDEGKD
KLEDFLKEISESLKDK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaatagatgaaagatttgaaaagctaaaaaaagagggaaaaaaagccttcata
ggctatgttacgtttgggtatccctcttttgaagagacacttgattatataaagcttgta
tattcatatgtagacattttagagattggttttcctttttctgaccctattgcagatggt
gagattattcaaaaagcctcaagaaaagctctcagtgaaggtgttaaattgaaccacctt
tttgaaagtattgaaaagtttaaaaaagataagccggttgtgctaatgctgtatgcaaac
acagtttacaaaaagggaattgatagattttttgaaagtagcaaaacttgcggtgtggat
ggcgtgataattcccgatgtttcgtttgaagagagctttgagttcaaagaagtagctgaa
aagtttggtattgtctatatagaccttgtatcaatatcttctcttgatagagctaagatg
atagcaaagcaggctaaaggttttttgtactgcgtttcaagaaaaggtgtgacaggcttt
aaagggcagattgatgataggatttttacttttctaaaagaactaaaaaccgttacctca
acacctttggcagttggatttggtataaagagtaaagaagatgttgagaaatttaaagac
cttgcagatggtattgttattggaagcgcaataatcacaaagatagatgaaggaaaagac
aaacttgaagattttttgaaagaaatctcagaaagtctaaaagacaaataa

DBGET integrated database retrieval system