KEGG   Caldicellulosiruptor obsidiansis: COB47_0895Help
Entry
COB47_0895        CDS       T01293                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    COB47_0895
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    COB47_0895
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    COB47_0895
Enzymes [BR:cob01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     COB47_0895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1015971..1016741
Genome map
AA seq 256 aa AA seqDB search
MNLIDERFEKLKKEGKKAFIGYVTFGYPSFEETLDYIKLVYSYVDILEIGFPFSDPIADG
EIIQKASRKALSEGVKLNHLFESIEKFKKDKPVVLMLYANTVYKKGIDRFFESSKTCGVD
GVIIPDVSFEESFEFKEVAEKFGIVYIDLVSISSLDRAKMIAKQAKGFLYCVSRKGVTGF
KGQIDDRIFTFLKELKTVTSTPLAVGFGIKSKEDVEKFKDLADGIVIGSAIITKIDEGKD
KLEDFLKEISESLKDK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaatagatgaaagatttgaaaagctaaaaaaagagggaaaaaaagccttcata
ggctatgttacgtttgggtatccctcttttgaagagacacttgattatataaagcttgta
tattcatatgtagacattttagagattggttttcctttttctgaccctattgcagatggt
gagattattcaaaaagcctcaagaaaagctctcagtgaaggtgttaaattgaaccacctt
tttgaaagtattgaaaagtttaaaaaagataagccggttgtgctaatgctgtatgcaaac
acagtttacaaaaagggaattgatagattttttgaaagtagcaaaacttgcggtgtggat
ggcgtgataattcccgatgtttcgtttgaagagagctttgagttcaaagaagtagctgaa
aagtttggtattgtctatatagaccttgtatcaatatcttctcttgatagagctaagatg
atagcaaagcaggctaaaggttttttgtactgcgtttcaagaaaaggtgtgacaggcttt
aaagggcagattgatgataggatttttacttttctaaaagaactaaaaaccgttacctca
acacctttggcagttggatttggtataaagagtaaagaagatgttgagaaatttaaagac
cttgcagatggtattgttattggaagcgcaataatcacaaagatagatgaaggaaaagac
aaacttgaagattttttgaaagaaatctcagaaagtctaaaagacaaataa

DBGET integrated database retrieval system