KEGG   Caldicellulosiruptor obsidiansis: COB47_1016Help
Entry
COB47_1016        CDS       T01293                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cob00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1133965..1134825
Genome map
AA seq 286 aa AA seqDB search
MKLKAYAKINLALDVLSKREDGYHEIRTIMQTVDLYDIINIEKIEEDNIIVTTSSENIPT
DNKNHAYIAASLLKERFGVKQGVRIHIEKNIPVSAGLAGGSTDAAAVLKGLNEIFELNLS
EQQLMEIGREIGADVPFCLVGGTALCEGIGEKVIKLKSAPQMNILIAKPEVYVSTQAVYE
ALDLSKVKKRPNIEAMISAIEEGNVKEIAKNLCNVLEVVTVNQYPVINRVKDIMRNNNAL
GTVMTGSGPAVFGIFSNRYDALKAAERLKVFIKEIILTTTCEGSGF
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactcaaggcttatgcaaaaatcaacttagcattggatgtgctttcgaaaagagaa
gatggctatcatgaaataagaactataatgcaaacagtggatttgtatgatataatcaat
attgaaaagatagaagaagacaacataattgtaacaacttcaagcgaaaatattccaact
gacaataaaaaccatgcatacattgcagcttcacttttaaaagagcgttttggtgtaaag
caaggcgtgagaatacatattgaaaagaatattcctgtctctgcgggtttagctggtgga
agcactgacgcagcagcagttttaaaaggtctgaatgaaatatttgagctaaatctttct
gagcagcagcttatggaaatcggaagagagattggcgctgatgttccattttgtttagta
ggcggcacagccctctgtgagggaattggcgaaaaggtgataaagctaaaatcagctcct
cagatgaatatcctcattgcaaagccagaggtatatgtttctacgcaggctgtgtatgag
gcgcttgaccttagcaaagtaaaaaagagaccgaatattgaagctatgatttcggcaatt
gaagaaggcaatgtaaaagagatagcaaagaacctttgcaatgttttagaggtggttacg
gtaaatcaatatccagttataaacagagtcaaggacattatgagaaataacaatgctctt
gggacagttatgacaggaagcgggccagctgtatttggaatttttagcaacaggtatgat
gctttgaaagctgcagagagacttaaagtgttcataaaagaaattatcttgactacaaca
tgtgaaggtagcggattttag

DBGET integrated database retrieval system