KEGG   Caldicellulosiruptor obsidiansis: COB47_1076Help
Entry
COB47_1076        CDS       T01293                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cob01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cob00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1197785..1199080
Genome map
AA seq 431 aa AA seqDB search
MRILNSKQQVENYIEMAQIRKWENEEEIEQKVRRIISDVKDKKDEALLYYTRLFDCEGIC
LDELQVSQEEIERAYFECEREDKDFIDALNTAYKNIYEYHMKQKEESWFYIKNGSVLGQI
IKPLEKVGIYVPGGKGAYPSTVLMNSVPAKVAGVEKIIMVSPPDKNKSISKYTLAAAKIC
GIDEIYRVGGAQAVAALAFGTQIIPKVDKIVGPGNIYVATAKKLLFGYVDIDSVAGPSEV
MVIADESANPKYIAADLLSQAEHDPMARCILVTTSLQVAQKVSESVEKMLAIFENSVALE
AIEKNGVIIVVESLFEAAEIANIIAPEHLEICCNDTEEVLLKIKNAGAIFIGEYSPEPIG
DYIAGPNHVLPTSGTASFFSPLGVYDFVKRMSLIKYSKEQFFLDAQHAINIAQKEGFLFH
ANSLKVRLEDV
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgagaatattgaatagtaagcaacaggttgaaaactacatagaaatggctcagataaga
aaatgggaaaacgaggaagaaattgaacaaaaggttcgcagaataatctctgatgtaaaa
gataaaaaagatgaagcgttgctttactacacccggctttttgattgtgagggtatttgc
ttggatgagctgcaagtaagccaagaagaaattgaaagagcatattttgaatgtgaaaga
gaagataaggatttcatagatgctttgaacactgcctataagaatatctatgagtatcac
atgaaacaaaaagaggaaagctggttttatataaaaaatggatcggttcttggtcagatc
ataaagcctcttgaaaaagtagggatttatgttccgggagggaaaggtgcgtacccttca
acagttttgatgaattcagttcctgcaaaggttgcaggcgtagagaagataataatggta
agtccacctgacaagaacaagagcatcagcaaatacactttggcagcagcaaaaatttgt
gggattgatgagatttatagagtaggaggggctcaagcagttgcagcacttgcgtttggg
acgcagattatacccaaggtagataagattgtgggaccaggaaatatctatgtagcaact
gctaaaaagttgttgtttggatatgtagatattgactcagtagcaggaccaagtgaagtc
atggttattgcagacgagtctgcaaatccgaaatacattgctgcagatttgctgtcacag
gcggaacatgatccaatggcaaggtgtattttagtaacaacatctttgcaggtggctcaa
aaggtttctgagagtgttgagaagatgcttgcaatctttgaaaactcagttgctttggaa
gctatagaaaaaaacggtgtgataatagttgttgaaagtctttttgaagctgctgagatt
gccaatataattgcacctgaacacttagagatttgttgcaatgatacagaggaagttttg
cttaaaattaaaaacgctggtgcaatttttataggtgaatattctcctgagcctattggt
gattatatcgcaggaccaaatcatgtgctgccaacgtctggcacagcaagtttcttctct
ccccttggggtttatgattttgtcaaaaggatgagtttaataaaatattcaaaagaacag
ttttttttagatgctcaacatgcaataaacatagcgcaaaaagaaggtttcctctttcat
gcaaattcgttgaaggtgaggttggaagatgtttaa

DBGET integrated database retrieval system