KEGG   Caldicellulosiruptor obsidiansis: COB47_1148Help
Entry
COB47_1148        CDS       T01293                                 

Definition
triosephosphate isomerase (EC:2.7.2.3 5.3.1.1)
Orthology
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:cob01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cob01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cob00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cob00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1269556..1271508
Genome map
AA seq 650 aa AA seqDB search
MPKLNKKTIRDIDVAGKRVLVRVDFNVPQDENGNITDDRRIREALPTIKYLIDHNAKVIL
VSHLGRPKGKFDPKYSMAPVAKRLSELLGKEVVLAKDVIGDDAKKCVEQMKEGDVVLLEN
VRFHKEEEENDREFAKALASLADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEIE
MLGNALANPQRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGAMAYTFLKAKGYKIGKS
KCEDDKLDVAREIMKKAEEKGVNLLLPVGSIVAKEFKNDTEFMYVPSDAMPDDMMGMDIG
NTTIELFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGDS
AAAVEKLGFADKMTHISTGGGASLEFLEGKVLPGIACLLDKNPRKKIIAANWKMNKTPQE
AKEFVEELKKYIDDVQAEVVICAPSILVPYVKEAIEGTNIKLGTQNMFYEEKGAYTGEIS
GPMLKEVGVEYVVIGHSERRQYFGETDEIVNKKVLAALKFGIKPIVCVGETLKQREYGIT
DELVRLQVKIALNGVSKEDVEKVVIAYEPIWAIGTGKNATPEEANRVIGVIRNVIAEMYD
EDTAQKVRIQYGGSVNSANSAEIFNMPEIDGGLVGGASLNAQEFAKILHY
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagctaaataagaagaccataagagatatagatgttgccggtaaaagggttctt
gtgagggttgactttaatgttcctcaagatgaaaatggcaatatcactgacgatagaaga
ataagagaggctcttcctacaataaagtatctcattgaccacaacgcaaaggtaatttta
gtatcccatttgggaagaccgaagggcaaatttgacccgaaatactcgatggctcctgtt
gcaaaaagactttctgagcttctcggcaaggaagttgttcttgcaaaagacgttataggc
gatgatgcaaaaaagtgtgttgaacagatgaaagaaggagatgtagttcttcttgaaaat
gtcagatttcacaaagaggaagaggaaaatgatagagaatttgcaaaggcgttagcatct
cttgcagacatttatgtaaacgatgcatttggtacagctcacagagcacatgcatcaaca
gcaggtgttgcagagttcttaccagcagttgctgggttcttaatggaaaaagagatagaa
atgcttggcaatgctcttgcaaatccgcaaagaccttttgttgcaatcttgggtggcgca
aaagtttctgacaagattggggttattacaaatcttcttgaaaaggttgatagcctctta
attggcggtgcaatggcttataccttcttgaaagcgaaaggatataaaatcgggaagtca
aaatgtgaagatgacaagcttgatgttgcaagagagataatgaaaaaggcagaggaaaaa
ggagtaaaccttcttttgcctgttggaagcatagtagcaaaagaatttaaaaatgataca
gagtttatgtatgtaccatcagatgcaatgccagacgatatgatgggtatggacatagga
aatactacaattgagctattctccaaggagataaagaaggcaaagacaattgtttggaac
ggaccaatgggtgtatttgaatttccaaactttgcaaagggaacagaagctatcgcaaga
gctgttgctgaggctgttgaagaaaatggtgcaattgcaattatcggtggtggcgactct
gcagctgctgtcgaaaaacttgggtttgctgataagatgacacatatctcaacaggtggc
ggtgcttcattagagttcttggaaggtaaagttttaccaggtattgcatgtcttcttgat
aaaaatccaaggaagaagataatcgcagcaaactggaagatgaacaaaactccacaagaa
gcaaaagagtttgttgaagagctgaagaagtatattgatgatgtgcaggcagaagtagtt
atctgtgctccatcaattcttgttccttatgtcaaagaagcaatagaaggaacaaatata
aaactcggaacacaaaacatgttctatgaagaaaaaggtgcatatacaggtgagatctcc
ggtccaatgttaaaggaagttggagttgagtatgtggtaattggtcactctgaaagaagg
cagtactttggtgaaacagacgaaattgtgaacaaaaaagttctggcagcgctgaaattt
ggtataaaacctattgtatgtgtcggtgagactttaaagcaaagagaatatggtattact
gacgaacttgtaagacttcaagtaaagattgcactgaatggtgtttctaaagaagacgtt
gaaaaggttgtcattgcatatgagcctatctgggcaataggtacaggcaagaatgcaaca
cctgaagaggcaaatagagtaattggggttatcagaaatgtaattgcagagatgtacgat
gaagatactgcgcaaaaggttagaatccagtatggtggtagtgtaaactctgcaaattca
gcagagattttcaatatgccagagattgatggaggattagttggcggtgcaagccttaat
gctcaggaatttgcaaagatattacactactaa

DBGET integrated database retrieval system