KEGG   Caldicellulosiruptor obsidiansis: COB47_1178Help
Entry
COB47_1178        CDS       T01293                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cob00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cob00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1301500..1302417)
Genome map
AA seq 305 aa AA seqDB search
MKHLLGLREISKEDILKILNLAKDMKTILKSETKKTPHLQGYSVVTLFYENSTRTRTSFE
LAAKFMSANTTSISVQTSSVQKGESLLDTVKTLEALKTDVLIVRHSVSGVPHFIAKNCSF
SVINAGDGMNEHPTQALLDMFTIRERLGTIEKLKIAIIGDILHSRVARSNIWGLSKFDNQ
ITVFGPQTLIPPYIENFAKVASSLEEAVSGKDVVIDLRIQLERQKRGFITSKQEYYKFYG
LNEDIMKYVSDNTLIMHPGPVNRGVEISSEIMQLPNSTINEQVTNGIAVRMAVLYLCTRK
EGIYR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacatttgcttggtttaagagagatttcaaaagaggatattttaaaaatactcaac
cttgcaaaagatatgaagacaattttaaagagtgaaactaaaaagactcctcatctgcag
gggtattcggttgtaactctgttttatgaaaatagtaccagaacacgaacatcgtttgag
cttgcagcaaagtttatgagtgccaatacaacctctatatctgtgcaaaccagtagtgtg
cagaaaggagagtctttgcttgacactgtaaaaactttggaagctctaaaaacagatgtg
ctaattgtcagacattcagtttctggtgtgccgcattttattgccaaaaactgctcattt
tcggtcataaacgctggtgatggaatgaatgagcatccaacacaggcactacttgatatg
ttcacaattagagaaaggcttggaacaattgagaaattgaagatagcaatcattggcgat
attcttcacagcagggttgcaaggagcaacatttggggactttccaagtttgacaaccaa
atcacagtgtttggaccacaaacacttattccaccttatattgaaaactttgccaaggtt
gcatcttctttggaagaggcagtctcaggaaaagatgttgtaatagatttgaggattcag
cttgagagacaaaaacggggctttataacctcaaagcaagaatattacaaattttatggg
ttaaacgaagatataatgaaatatgtttcagacaacaccttgattatgcaccctggtcct
gtcaacagaggagttgaaatctcttcagaaattatgcaactgccaaattcaactatcaat
gagcaagttacaaacggtattgctgttagaatggcagttttatacctttgcacacgcaag
gagggaatttacaggtga

DBGET integrated database retrieval system