KEGG   Caldicellulosiruptor obsidiansis: COB47_1178Help
Entry
COB47_1178        CDS       T01293                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
cob00240  Pyrimidine metabolism
cob00250  Alanine, aspartate and glutamate metabolism
cob01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    COB47_1178
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    COB47_1178
Enzymes [BR:cob01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     COB47_1178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace DUF5301 T_Ag_DNA_bind
Motif
Other DBs
NCBI-ProteinID: ADL42475
UniProt: D9TKE3
Position
complement(1301500..1302417)
Genome map
AA seq 305 aa AA seqDB search
MKHLLGLREISKEDILKILNLAKDMKTILKSETKKTPHLQGYSVVTLFYENSTRTRTSFE
LAAKFMSANTTSISVQTSSVQKGESLLDTVKTLEALKTDVLIVRHSVSGVPHFIAKNCSF
SVINAGDGMNEHPTQALLDMFTIRERLGTIEKLKIAIIGDILHSRVARSNIWGLSKFDNQ
ITVFGPQTLIPPYIENFAKVASSLEEAVSGKDVVIDLRIQLERQKRGFITSKQEYYKFYG
LNEDIMKYVSDNTLIMHPGPVNRGVEISSEIMQLPNSTINEQVTNGIAVRMAVLYLCTRK
EGIYR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacatttgcttggtttaagagagatttcaaaagaggatattttaaaaatactcaac
cttgcaaaagatatgaagacaattttaaagagtgaaactaaaaagactcctcatctgcag
gggtattcggttgtaactctgttttatgaaaatagtaccagaacacgaacatcgtttgag
cttgcagcaaagtttatgagtgccaatacaacctctatatctgtgcaaaccagtagtgtg
cagaaaggagagtctttgcttgacactgtaaaaactttggaagctctaaaaacagatgtg
ctaattgtcagacattcagtttctggtgtgccgcattttattgccaaaaactgctcattt
tcggtcataaacgctggtgatggaatgaatgagcatccaacacaggcactacttgatatg
ttcacaattagagaaaggcttggaacaattgagaaattgaagatagcaatcattggcgat
attcttcacagcagggttgcaaggagcaacatttggggactttccaagtttgacaaccaa
atcacagtgtttggaccacaaacacttattccaccttatattgaaaactttgccaaggtt
gcatcttctttggaagaggcagtctcaggaaaagatgttgtaatagatttgaggattcag
cttgagagacaaaaacggggctttataacctcaaagcaagaatattacaaattttatggg
ttaaacgaagatataatgaaatatgtttcagacaacaccttgattatgcaccctggtcct
gtcaacagaggagttgaaatctcttcagaaattatgcaactgccaaattcaactatcaat
gagcaagttacaaacggtattgctgttagaatggcagttttatacctttgcacacgcaag
gagggaatttacaggtga

DBGET integrated database retrieval system