KEGG   Caldicellulosiruptor obsidiansis: COB47_1242Help
Entry
COB47_1242        CDS       T01293                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cob00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1363229..1364086)
Genome map
AA seq 285 aa AA seqDB search
MSFNLYKPFFLCASEKYEDSLIVLAGIPMDFTVSFKPGSRFAPAKIREVSIELEEYSIYQ
DKSLYDKTFCDMGDLELPFGNIERSIETIYQFACKLFEDKKVPIFLGGEHLISFPLIKAA
ANSNDGEFYVLHFDAHADMREEYLGEKFSHATVMRRVGEVIGFKSIYHFGIRSGSKEEIE
FAKKNSNLYFVNKWGKIDDVIKNLKSKKVYLSIDIDVFDPAFAPGTGTPEPGGILSSDFF
DILLKLKDLDIIGADIVEVAPYYDISDRTALLAAKIVRELILMMK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaatctctacaaaccttttttcctatgtgcttcagagaagtatgaagatagc
ctcatagttttagcaggaattcctatggatttcacagtaagctttaaacctggctcgcgt
tttgctcctgcaaaaataagagaagtgtcaatagagctggaagagtattctatctatcag
gacaaaagcctgtatgacaagactttttgtgatatgggtgatctggaacttccttttgga
aacatcgaaagaagtattgaaacaatataccaatttgcttgtaagctgtttgaagataaa
aaagtccctattttcttaggcggtgaacatctgatcagctttcctctaataaaagcggcg
gcaaactcaaatgatggggagttttatgtacttcactttgatgctcatgctgatatgaga
gaggagtatcttggtgaaaagttttctcatgccactgtcatgagaagagtgggtgaggta
ataggttttaagagtatataccacttcggtataaggtctgggtctaaagaagaaattgaa
tttgcgaaaaagaatagcaatctttattttgttaacaaatggggtaaaattgatgatgta
ataaaaaatctaaaaagcaagaaggtatatctttcgatagatatagatgtttttgatcca
gcttttgcccctggtacaggaacacctgaaccaggtggaattctatcttcggactttttt
gacattttacttaaattaaaagatcttgacataataggagcagatatagttgaggttgca
ccatattacgatatttctgacagaacagcattacttgctgcaaaaatagtaagagagcta
atattgatgatgaagtaa

DBGET integrated database retrieval system