KEGG   Caldicellulosiruptor obsidiansis: COB47_1292Help
Entry
COB47_1292        CDS       T01293                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COB47_1292
   01230 Biosynthesis of amino acids
    COB47_1292
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COB47_1292
   00030 Pentose phosphate pathway
    COB47_1292
   00051 Fructose and mannose metabolism
    COB47_1292
   00052 Galactose metabolism
    COB47_1292
  Energy metabolism
   00680 Methane metabolism
    COB47_1292
Enzymes [BR:cob01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     COB47_1292
Protein phosphatases and associated proteins [BR:cob01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     COB47_1292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1411291..1412259)
Genome map
AA seq 322 aa AA seqDB search
MPEVRTIGVLTSGGDAPGMNAAIRAVVRTGIYYGFRVMGIRRGYNGLIEGDIFEMNLRSV
SDIIQRGGTILLTARSPEFMTENGLKKAASMCKIFKIDALVVIGGDGSFRGARDLSKFGI
NVVGIPGTIDNDIACTDYTIGFDTALNTVQDAINKIRDTATSHERVSILEVMGRHAGYIA
LYSGIAGGAESIVIPEKGLDKDEIIRRIIDGKNKGKLHNLIILAEGIGGATELAKEIEEA
TGIETRATILGYIQRGGSPTAYDRVVASLMGAKAVEVIKEGKQNRIIAMKDGKIVDYDID
EALSMQKSIDEYMYNLATILSL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagtgagaactattggtgttttgacaagtggtggagacgcaccaggaatgaac
gctgctatacgtgctgttgtaagaacgggtatatactatggatttagagtgatgggcata
agacgcgggtataatggtcttattgaaggcgacatttttgagatgaacctgaggtctgtt
tcagatataatccaacgcggtggaacaatacttttgactgcaaggtctcctgagtttatg
acagaaaatgggctcaaaaaagctgcttcaatgtgcaagatattcaagattgatgctctt
gttgtaattggcggagacgggtctttcaggggtgcaagagacctgagtaaatttggcata
aatgttgttggaattcctggaaccatcgacaatgatattgcatgtacagattacaccata
gggtttgacacagcattgaatactgtacaggatgcaattaacaagataagagatacagca
acctcccatgaaagagttagtatccttgaagtaatggggcgtcatgctggatatatagca
ctttacagtgggattgcaggaggagcagagtcaatagtaattcctgaaaaaggtcttgat
aaggatgagataatcagaagaataattgatggcaaaaacaaaggaaagctccacaacttg
attatattagctgaaggaatcggtggagcaacagagcttgcaaaagagattgaagaagca
acgggaatagagacaagagcgaccatccttggatatatccagagaggtggttcaccaact
gcatatgacagagttgttgcgagtttgatgggggcaaaagctgttgaggtgattaaagaa
gggaagcagaataggataattgcaatgaaggatggtaagattgttgattatgatattgac
gaagcactttctatgcaaaagtcaattgatgaatacatgtacaacttagctactatcctt
tctttataa

DBGET integrated database retrieval system