KEGG   Caldicellulosiruptor obsidiansis: COB47_1418Help
Entry
COB47_1418        CDS       T01293                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cob00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    COB47_1418
Enzymes [BR:cob01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     COB47_1418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1535517..1536110)
Genome map
AA seq 197 aa AA seqDB search
MIDSIMGTIQEVFSNYIILNYNNLYIKIHCNGAKFSEFLGKEKRVYVSLKFNENLSELEC
YGFLTREERELFLKLQKVTGVGSKLALQILSSIDFQELIVEIAKGNVARLEKVKGIGKKT
ASRIILELKETLKKEFKVAATTGKEEKTYEKLEEISLALLSLGYDIDEVNQVLSSGDFSE
LSLEDGIKLALKKLSKI
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgatagattctattatgggaaccatccaagaggtatttagtaactatattatcctcaat
tataacaatttatacataaaaatacattgtaatggcgcaaaattttctgaatttttaggc
aaagaaaagagagtgtatgttagcctaaagtttaatgaaaatttatcagagcttgaatgt
tatggttttttgacaagagaggaaagagaactttttttaaagcttcagaaggtaactggt
gttggtagcaaattagctcttcagattctttcctcaatagactttcaagagcttattgtt
gagattgcaaaaggaaatgtggcaagacttgagaaggtaaaaggaattgggaaaaaaact
gcaagcaggataattcttgagctcaaagagacactcaaaaaagagtttaaagtggctgcc
actacaggtaaagaagaaaaaacttacgaaaaacttgaagaaatatctttagcactttta
tccttggggtatgacattgatgaagtcaaccaggttctttcatccggagatttttctgaa
ctttctttggaagatggaataaaacttgctttgaaaaagttatcaaagatttga

DBGET integrated database retrieval system