KEGG   Caldicellulosiruptor obsidiansis: COB47_1490Help
Entry
COB47_1490        CDS       T01293                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    COB47_1490
Enzymes [BR:cob01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     COB47_1490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1605275..1605874)
Genome map
AA seq 199 aa AA seqDB search
MRNGLLIVISGPAGTGKGTVVGKLLEKNPNIKLSISKTTRKPRPGEKEGMNYFFVSREQF
EEEIKNERFLEYAEYNNNYYGTPKDFVFETLEKGFDVILEIETKGALQIKKVFSDAVLIF
LLPPSIEELYKRLVKRGTESEDEIKARLEIAKNEIKLVPEYDYCVINDNVDDATEKIQKI
IEVEKLKSRRFDIQRFLKE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatggacttttgattgtaatatcagggcctgcaggaactggaaagggtacagtt
gttggaaagcttcttgagaaaaatcctaatatcaagctttcaatctccaagacgaccaga
aaaccacggccaggggaaaaagaaggcatgaattatttttttgtctcgcgcgagcaattt
gaagaagagattaaaaacgaaaggtttttagaatatgctgaatataacaacaactattat
ggtacgcccaaagactttgtctttgaaacattggaaaaaggttttgatgtaattttggag
attgagacaaaaggagcacttcagattaaaaaagtattttcggatgcagtactgatattt
ttactgcccccatccatagaagagctttacaaaagacttgtaaaaagaggtaccgagtct
gaagatgaaatcaaggcaagacttgagattgccaagaacgagataaaacttgtgcctgag
tatgactattgtgttataaatgacaatgtggatgatgctactgaaaagatacaaaagatt
attgaagttgaaaagctaaagagtaggagatttgatatacaaagatttttgaaggagtga

DBGET integrated database retrieval system