KEGG   Caldicellulosiruptor obsidiansis: COB47_2291Help
Entry
COB47_2291        CDS       T01293                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
cob03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cob00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    COB47_2291
Enzymes [BR:cob01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     COB47_2291
DNA repair and recombination proteins [BR:cob03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     COB47_2291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 HHH_5 PIF1 Helicase_RecD UvrD_C UvrD-helicase ATPase_2 T2SSE AAA_12 AAA_24 DEAD HHH_2 NTPase_1 AAA_22 AAA_29 DUF853 ABC_tran DUF2075 AAA PhoH ABC_ATPase ArgK SpoIISA_toxin RsgA_GTPase AAA_16 AAA_25 AAA_23 Mg_chelatase TrwB_AAD_bind AAA_28
Motif
Other DBs
NCBI-ProteinID: ADL43527
UniProt: D9THQ2
Position
complement(2491411..2493636)
Genome map
AA seq 741 aa AA seqDB search
MQQNIQGMVSDIIYRNLENSYTVFEIICDDEVFTAVGIVPDIAIGEKVSVYGEFYVHPVY
GQQLKVSYLEKLLPQTKDEIYLYLSSGVIKGIGQKTAKKIVDTFGDDTARVLQEEPEKLL
SIRGMTPEKVERIRNMFAFQKFLKDIMSIFSQYGLSQNHAMRLFKLYGFSALSLLQENPY
FLLEVFPELDFKKVDRLALDMGVMPDDGRRISAKILNLLTLAANSEGHTCLPENRLKQVC
SKTLDLPVEKIEDALEVLAQERRIVKDEVESQKMVFLYGYYECEKYIADKILSMLKEYDD
IADIDEKISQFEAKNGIAFSPNQKKAIKMALTQGVSIITGGPGTGKTTIIKCIIQIFEGE
GKKVFLCAPTGRAAKRMQAACERESKTIHRLLEMTVLDTHVIFQKGPNNPLKCDAIVVDE
MSMVDSFLMNYLLAATKPTTRIVLVGDKDQLPSVGAGNVLKDLIKSEIVPCTTLTEVYRQ
SENSFIVLNAHRINRGEFPHLQKESDFYFIQKNSQEEILKTVIELVIKKVPNYLSCDPMT
DIQVLCPSKKGIVGMYNLNRVLQQYLNPPHPSKKEYAYKENLFRVGDKVMQVKNNYSLEY
EILQGEEKGKVSTGIFNGDIGVVKDIDRAQGVLEILFDDEKFVYYDFSLLDDLELAYAMT
VHKSQGSEFRCIVMPVVETYPILMTRNLLYTAVTRAKELVVLVGKKSALEYMIANQKEAM
RYSALCDFLLRGQENMQVRAL
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaaacattcaaggtatggttagcgatataatctacaggaatttggaaaatagc
tatacggtgtttgagataatctgcgacgatgaggtgttcacagcagtagggatagttcca
gacattgctatcggtgaaaaggtgagcgtatacggtgagttttatgttcatcctgtttac
ggtcagcagctgaaagtaagctaccttgagaaacttctgccgcagacaaaggatgagata
tatctttatctttcctctggagtaataaaaggtatcgggcagaagactgcaaagaagatt
gttgatacctttggagatgacactgcaagagttttgcaggaagagcctgaaaagcttctt
agtattcgcggcatgacacccgaaaaggttgagcgaataaggaatatgtttgcattccaa
aaatttttgaaagatatcatgtcaatcttttcccagtacgggctttcacagaaccatgca
atgagactttttaaactttatggattttctgctctgtcgcttttacaggaaaatccatat
tttcttttagaagtgttcccagagcttgactttaaaaaggttgacaggcttgcacttgac
atgggagttatgccagatgacggaagaagaatatctgccaagatacttaatcttttgaca
ctggcagcaaatagtgaagggcatacctgcctgccagaaaataggctcaaacaggtttgt
tcaaaaactcttgaccttccagtggaaaaaatagaagatgcgcttgaagttttagctcaa
gaaagaagaattgtaaaagatgaagttgaatctcaaaagatggtgtttttgtacggttac
tatgagtgtgaaaagtatatagcagataaaatcctgtcaatgctaaaagaatatgatgac
attgctgatatagatgaaaagatctctcagtttgaagcaaaaaacggtattgcattttcg
ccaaatcaaaagaaagccatcaagatggcactgactcaaggcgttagcattatcacagga
ggtcctggtacaggaaagacaacaataataaaatgcattattcaaattttcgagggtgaa
ggcaaaaaggtttttctttgtgcaccaacaggaagagctgcaaagaggatgcaggcagcc
tgcgaaagagaatcaaaaacaatccacagacttttggaaatgacagttttagacacacat
gttattttccaaaaaggaccaaataatcccttaaaatgcgatgctatagtggtggatgaa
atgagcatggtagacagtttcctgatgaactatcttcttgctgcaacaaaaccgacaaca
agaattgtgcttgttggagacaaagaccagcttccatctgttggtgcagggaatgtctta
aaagaccttataaaaagcgaaattgtaccttgcaccactttgacagaggtgtatcgccag
agcgaaaatagctttatagtcctcaatgcacacaggataaacagaggtgagtttccacat
cttcaaaaggagagcgatttttattttatccagaaaaactctcaggaagagattttaaaa
actgtaattgaacttgtgataaaaaaggttccaaactatctttcgtgcgatccgatgaca
gacatccaggtcctgtgtccttcaaaaaaagggattgttgggatgtacaacttaaatcgt
gtgctgcagcagtacttaaacccacctcatccttctaaaaaagagtatgcttataaagaa
aacctgttcagagttggagacaaggtcatgcaggtaaaaaacaactattcacttgaatat
gagattttacaaggagaggagaagggcaaagtctcaacagggatattcaatggcgacatt
ggagttgtcaaagatattgacagggcgcaaggtgtgctggaaatcctgtttgacgatgaa
aagtttgtgtattatgacttttcgctgcttgacgatttagaacttgcatatgcaatgact
gttcacaaatcgcaagggtcagagttcaggtgcatagtgatgcctgttgttgagacctac
cccattttgatgacaagaaaccttctttacactgccgtaacacgagcaaaagaacttgtt
gtgttggtgggtaaaaaaagcgcgcttgaatacatgatagcaaaccaaaaagaggctatg
cgatattcagcactttgcgactttttattgcgcgggcaagaaaatatgcaagtgcgagct
ttataa

DBGET integrated database retrieval system