KEGG   Caldicellulosiruptor obsidiansis: COB47_2320Help
Entry
COB47_2320        CDS       T01293                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cob00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation
Environmental Information Processing; Signal transduction; Two-component system [PATH:cob02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2518392..2520032
Genome map
AA seq 546 aa AA seqDB search
MKRFLMHRKNIIVSFLLILCLILSTLAFAQQDEPNSQKVKNVILMIPDGMTISHTSLARW
YQDGEPLSMDEIACGLIRTHSANNPITDSAPAATAYATGFKTQNRYLSIYPEMVSMPGVG
QVDEKDFYKPIVTILEAAKKVGKATGLVFTCQFPHATPAAFASHSDNRNDYENIAEQMVY
NQVDVVFGGGYRYIDKNQRKDNEDLAGYLKENGFFVTPSWHEAKNFYGQKIWGLFAQDAM
HYDFDRNGSGEPSLAEMTQKAIQLLSKNRNGFFLMVEGSEIDWASHANDPVGVISDVLAF
DRAVKVTLEFAKSRNDTAVIIAPDHSNGGMSIGNYSTKYDTAMLNDFLKYIKKAKRTGAG
IEELLGNNKTDENIKKIVSEYYGVDNLTQDEINAIKNAKTGELNYVLGPIISKRSNLGWT
TNGHTGDDVVLYAYHPNNYIPKGAIDNTEICDYMAEILGIDLGNFNENAYISNIDLEEKG
YNVSIDTSNPSNVQFVISKGNKTYIIPQNKNVVLEGSNQYRVKYVSVYIPTAKRFFVSSE
VENLIK
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatttttaatgcatagaaaaaacataattgtctcttttcttttgatactttgc
ctaattttatcaaccttagcatttgcacagcaggatgagccaaatagtcaaaaggttaaa
aatgttattttaatgattccagatggtatgacaatttctcacacaagtcttgcacgctgg
taccaggatggagaacctctctcaatggatgaaattgcatgtggactgataagaacacat
tcagcaaacaacccaattacagactcagcaccagctgcaacagcttatgcaacagggttt
aaaactcaaaacagatacctttcaatatatcctgaaatggtttcaatgcctggtgtaggt
caggttgatgaaaaagatttttataaaccaattgtgactatcttagaagctgccaagaag
gttggaaaggcaacagggcttgttttcacatgccagttcccacacgcaacacctgctgcg
tttgcatcacattcagataacagaaatgattatgagaatatagccgagcagatggtttac
aatcaggttgatgtggtgtttggcggtggttatagatacattgataaaaatcagagaaaa
gacaatgaagatttagcaggatacctaaaagaaaacggcttttttgtaacaccaagctgg
catgaagcaaaaaacttttatggacagaaaatctgggggctttttgcgcaggatgcaatg
cactacgattttgacagaaacgggtcaggtgagccgtctttggctgaaatgactcaaaaa
gctattcaacttctttctaaaaatagaaacggatttttcttgatggtggaaggcagtgaa
attgactgggcatcacacgcaaacgaccctgttggagtcatttcagatgttcttgcattt
gacagggctgtgaaagttacacttgaatttgcaaaatcaagaaatgatacagcagtgata
attgcacctgatcatagcaatggtggtatgagcataggaaattattcaacaaagtatgat
acagcaatgctaaatgattttttgaaatatatcaaaaaagcaaaaagaacaggggctgga
atagaagaacttttgggtaacaacaaaacagatgagaatattaaaaaaatagtgtctgaa
tattatggagtagataatctgacacaagatgaaataaacgctattaaaaatgcaaagaca
ggagaactcaactatgtgctcggaccaattatcagcaaaaggtcaaacctcggctggaca
acaaacggtcatacaggtgacgatgtagtgttatatgcatatcatccaaacaactatata
ccaaaaggagcaattgacaatacagagatttgtgattatatggcagaaatccttggcatc
gatcttggaaactttaatgaaaacgcatatatctcaaacattgacttagaggaaaaaggg
tataatgtctctattgatacaagcaatccttcaaatgtccagtttgtgataagtaaagga
aataagacatacattattccacaaaataaaaatgtggtattagaaggttctaatcagtac
agggtaaaatacgtaagcgtgtatattccaacagctaaaaggttttttgtatcaagtgag
gttgaaaatttgattaaataa

DBGET integrated database retrieval system