KEGG   Caldicellulosiruptor obsidiansis: COB47_2320Help
Entry
COB47_2320        CDS       T01293                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    COB47_2320
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    COB47_2320
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    COB47_2320
Enzymes [BR:cob01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     COB47_2320
Exosome [BR:cob04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   COB47_2320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2518392..2520032
Genome map
AA seq 546 aa AA seqDB search
MKRFLMHRKNIIVSFLLILCLILSTLAFAQQDEPNSQKVKNVILMIPDGMTISHTSLARW
YQDGEPLSMDEIACGLIRTHSANNPITDSAPAATAYATGFKTQNRYLSIYPEMVSMPGVG
QVDEKDFYKPIVTILEAAKKVGKATGLVFTCQFPHATPAAFASHSDNRNDYENIAEQMVY
NQVDVVFGGGYRYIDKNQRKDNEDLAGYLKENGFFVTPSWHEAKNFYGQKIWGLFAQDAM
HYDFDRNGSGEPSLAEMTQKAIQLLSKNRNGFFLMVEGSEIDWASHANDPVGVISDVLAF
DRAVKVTLEFAKSRNDTAVIIAPDHSNGGMSIGNYSTKYDTAMLNDFLKYIKKAKRTGAG
IEELLGNNKTDENIKKIVSEYYGVDNLTQDEINAIKNAKTGELNYVLGPIISKRSNLGWT
TNGHTGDDVVLYAYHPNNYIPKGAIDNTEICDYMAEILGIDLGNFNENAYISNIDLEEKG
YNVSIDTSNPSNVQFVISKGNKTYIIPQNKNVVLEGSNQYRVKYVSVYIPTAKRFFVSSE
VENLIK
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatttttaatgcatagaaaaaacataattgtctcttttcttttgatactttgc
ctaattttatcaaccttagcatttgcacagcaggatgagccaaatagtcaaaaggttaaa
aatgttattttaatgattccagatggtatgacaatttctcacacaagtcttgcacgctgg
taccaggatggagaacctctctcaatggatgaaattgcatgtggactgataagaacacat
tcagcaaacaacccaattacagactcagcaccagctgcaacagcttatgcaacagggttt
aaaactcaaaacagatacctttcaatatatcctgaaatggtttcaatgcctggtgtaggt
caggttgatgaaaaagatttttataaaccaattgtgactatcttagaagctgccaagaag
gttggaaaggcaacagggcttgttttcacatgccagttcccacacgcaacacctgctgcg
tttgcatcacattcagataacagaaatgattatgagaatatagccgagcagatggtttac
aatcaggttgatgtggtgtttggcggtggttatagatacattgataaaaatcagagaaaa
gacaatgaagatttagcaggatacctaaaagaaaacggcttttttgtaacaccaagctgg
catgaagcaaaaaacttttatggacagaaaatctgggggctttttgcgcaggatgcaatg
cactacgattttgacagaaacgggtcaggtgagccgtctttggctgaaatgactcaaaaa
gctattcaacttctttctaaaaatagaaacggatttttcttgatggtggaaggcagtgaa
attgactgggcatcacacgcaaacgaccctgttggagtcatttcagatgttcttgcattt
gacagggctgtgaaagttacacttgaatttgcaaaatcaagaaatgatacagcagtgata
attgcacctgatcatagcaatggtggtatgagcataggaaattattcaacaaagtatgat
acagcaatgctaaatgattttttgaaatatatcaaaaaagcaaaaagaacaggggctgga
atagaagaacttttgggtaacaacaaaacagatgagaatattaaaaaaatagtgtctgaa
tattatggagtagataatctgacacaagatgaaataaacgctattaaaaatgcaaagaca
ggagaactcaactatgtgctcggaccaattatcagcaaaaggtcaaacctcggctggaca
acaaacggtcatacaggtgacgatgtagtgttatatgcatatcatccaaacaactatata
ccaaaaggagcaattgacaatacagagatttgtgattatatggcagaaatccttggcatc
gatcttggaaactttaatgaaaacgcatatatctcaaacattgacttagaggaaaaaggg
tataatgtctctattgatacaagcaatccttcaaatgtccagtttgtgataagtaaagga
aataagacatacattattccacaaaataaaaatgtggtattagaaggttctaatcagtac
agggtaaaatacgtaagcgtgtatattccaacagctaaaaggttttttgtatcaagtgag
gttgaaaatttgattaaataa

DBGET integrated database retrieval system