KEGG   Capnocytophaga ochracea: Coch_0024Help
Entry
Coch_0024         CDS       T00961                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
coc  Capnocytophaga ochracea
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:coc01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:coc00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:coc00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
26973..28256
Genome map
AA seq 427 aa AA seqDB search
MARHELIFPSLGESVTEAVVTNWLKKVGDPVEAEESIVEVSTDKVDTEVPTDVSGILAEI
KFQVNDVVKVGEVIAVIETQEEISTSGEKLDVVQQSVASLEKNIANIQQSTSAEPQVDFS
KTERFYSPLVKNIAKKEGISLSELDSIKGTGLNDRVTKSDILDYLSHRTQGKAKPSATFD
ATPADKRVYTKRGEERIEMSRMGKLIAEHMLKSKLTSAHVQSFIEVDVTRIWKWRNKVKK
AFEEREGEKFTFTPIFMEVVAKALVDFPMMNVSVEGDSIIKKRNINIGMATALSDGNLIV
PVIKNADELSLRGMAKVVNDLANRARANALKPDEVKDGTYTVTNIGSFGTLFGTPIINQP
QVGILAIGAIQKVPAVIETPEGDTIGIRYKLMLSHSYDHRVVNGALGGMFVQRVAKYLEE
WDMNRVL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggcaagacatgaattaattttcccttcattaggagaaagtgtaacagaggctgttgtt
accaactggctgaaaaaagtaggcgatcctgtagaagccgaagaaagtattgtggaagta
tccacagataaagtagatactgaagtacctactgatgtgtcgggtatattggctgaaatc
aagtttcaagtgaatgacgttgtgaaagtaggtgaagtaatagctgttattgagacacaa
gaagagattagcacttctggagaaaagcttgatgttgtacaacaatcggttgcaagttta
gaaaagaacattgctaacatacaacaaagtacctcagctgagccacaagtagacttcagc
aaaacagagcgtttctattcacctttggtaaagaatatcgctaagaaagaaggtatcagt
ttaagcgagttagacagcatcaaaggaacaggcttaaacgaccgtgtaaccaagagtgat
attcttgactatctatcgcataggacacaaggaaaagcaaagccttcagctacttttgat
gctactcctgccgataagagagtttataccaaacgcggtgaagaacgaattgagatgagt
cgtatgggtaaactcattgcagagcatatgctaaaaagtaaacttacttcagcacacgta
caaagttttattgaggtagatgtaacccgtatatggaaatggcgcaataaagtaaaaaaa
gcatttgaagagcgcgaaggtgagaaattcacttttacacctatctttatggaagtggtt
gccaaagcacttgttgattttcctatgatgaatgtctcagtagaaggggatagcattatc
aagaagagaaatattaatataggtatggctactgcgctatcagacggcaacctaattgtt
cccgttataaaaaacgctgatgagctcagtttaagaggtatggcaaaagtagtaaatgac
cttgctaatagagctcgtgctaatgcactcaagcccgatgaagtgaaagatggtacatat
acagtaaccaatataggttcatttggcactttgtttggcactcctattattaatcagcca
caagtaggtatcttagcaataggagctatccaaaaagttcctgctgtaattgaaactcca
gaaggagacacaataggcattcgttataaactaatgctttctcacagttatgaccatcgt
gttgtaaatggagccttaggaggaatgtttgtacagcgtgtagctaaatatcttgaagag
tgggatatgaatagagtactataa

DBGET integrated database retrieval system