KEGG   Capnocytophaga ochracea: Coch_0061Help
Entry
Coch_0061         CDS       T00961                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
coc  Capnocytophaga ochracea
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Coch_0061
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Coch_0061
   00020 Citrate cycle (TCA cycle)
    Coch_0061
   00620 Pyruvate metabolism
    Coch_0061
Enzymes [BR:coc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Coch_0061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(80011..81627)
Genome map
AA seq 538 aa AA seqDB search
MAEIITMPRLSDTMEEGVVAKWLKKVGDKVNEGDILAEIETDKATMEFESFHTGTLLYIG
LKEGESAKVDTLLAIIGKEGEDISALIAGGAQASAPKAEEAKPVAEVTTAPVAGATIPAG
VEVVTMPRLSDTMTEGTVASWLKKVGDTVKEGDILAEIETDKATMEFESFYSGTLLYIGL
KEGESAAVDSLLAIIGPAGTDVNAVLAAVKAGGASTSAPSTPKAESKPAETATSATTSVA
NANDRVFASPLAKKIAQDKGINLTEVKGTGENGRIVKKDVENFTPSAKVATATTATPATA
SAAIPTVIPVGVEVTEEVKNSQMRKTIAKRLAESKFTAPHYYLAIEIDMDNAMESRAQIN
NLPDTKISFNDMVVKACAMALKKHPQVNTSWKGDTTLYNKHVNVGVAVAIEDGLVVPVIK
FTDTLTLTQIGALVKDLAGKARNKKLTPAEMEGSTFTVSNLGMFGVDVFTSIINQPNSAI
LSVGAIVEKPVVKNGQIVVGHTMQVTLACDHRTIDGATGAQFLQTLKAYIENPVTMLA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattattactatgccacgcttgagcgacactatggaagagggtgttgtagca
aagtggcttaaaaaagtaggcgataaagtaaatgaaggcgatatcttagcagaaatcgag
acggataaagctacaatggaatttgaatcattccatacaggaaccttattgtatataggt
ttaaaagaaggagaaagtgctaaagtagataccttattggctatcataggtaaagagggt
gaagatatttcggcacttatagctggaggagctcaagcatcggctcctaaagctgaagaa
gctaaacctgttgctgaggtaactacggctcctgttgctggtgctactataccagcagga
gtagaagtggtaacaatgcctcgactcagtgatacaatgacggaaggtactgtggcttct
tggctcaaaaaggtaggtgatactgtaaaagaaggtgatatcttagctgaaattgaaacc
gataaggctacaatggagtttgaatcattttactcaggtactttattgtatataggttta
aaagaaggagaaagcgcagcagtagattcattattggcgattataggccctgcgggtact
gatgtgaacgcagttttggcagccgtgaaagctggcggagcttcaacttcggctccttca
actcctaaggctgaaagcaaaccggctgaaacagccacatcagctactacttcggtagct
aatgcaaacgaccgcgtatttgcttctcctttggctaagaaaatagcacaagataaaggt
attaaccttactgaggtgaaaggaacaggtgaaaatggacgtattgtgaagaaagacgta
gaaaactttacaccaagtgctaaggttgctacggctactacggctacacctgcaaccgct
agcgcagctatcccaactgtaattcctgtgggagtggaagtaactgaagaggtgaaaaac
tcacaaatgcgcaaaacgattgcgaaacgtttggcagaatctaaatttactgcacctcac
tactatttggcaatagaaattgatatggataacgcgatggaatctcgcgctcaaatcaac
aatttgccagacaccaaaatatctttcaacgatatggtagtgaaagcctgcgcaatggca
cttaaaaaacaccctcaagtaaatacttcttggaaaggcgataccaccctttacaacaag
cacgtgaatgtaggggtggctgtggctattgaagatggcttggtagtacctgttatcaag
tttacggatactttaacgcttactcaaataggcgccttggtaaaagacttggctggtaag
gcacgcaacaagaaacttactcctgccgaaatggaaggaagtactttcactgtgtctaac
ttgggtatgtttggggtagatgtatttacttctatcatcaatcagcctaactctgctatt
ctttcagtaggagctattgttgagaaacctgtagtgaaaaacggacaaatagtagtaggt
cacactatgcaagtaactcttgcttgcgaccaccgtactatcgacggggctactggagct
caattcttacaaacactcaaagcttatattgagaatcctgtaacaatgctcgcataa

DBGET integrated database retrieval system