KEGG   Capnocytophaga ochracea: Coch_0061Help
Entry
Coch_0061         CDS       T00961                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
coc  Capnocytophaga ochracea
Pathway
coc00010  Glycolysis / Gluconeogenesis
coc00020  Citrate cycle (TCA cycle)
coc00620  Pyruvate metabolism
coc01100  Metabolic pathways
coc01110  Biosynthesis of secondary metabolites
coc01120  Microbial metabolism in diverse environments
coc01130  Biosynthesis of antibiotics
coc01200  Carbon metabolism
Module
coc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Coch_0061
   00020 Citrate cycle (TCA cycle)
    Coch_0061
   00620 Pyruvate metabolism
    Coch_0061
Enzymes [BR:coc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Coch_0061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 PYNP_C RnfC_N Monooxygenase_B
Motif
Other DBs
NCBI-ProteinID: ACU91626
JGI: Coch_0061
UniProt: C7M4J6
Position
complement(80011..81627)
Genome map
AA seq 538 aa AA seqDB search
MAEIITMPRLSDTMEEGVVAKWLKKVGDKVNEGDILAEIETDKATMEFESFHTGTLLYIG
LKEGESAKVDTLLAIIGKEGEDISALIAGGAQASAPKAEEAKPVAEVTTAPVAGATIPAG
VEVVTMPRLSDTMTEGTVASWLKKVGDTVKEGDILAEIETDKATMEFESFYSGTLLYIGL
KEGESAAVDSLLAIIGPAGTDVNAVLAAVKAGGASTSAPSTPKAESKPAETATSATTSVA
NANDRVFASPLAKKIAQDKGINLTEVKGTGENGRIVKKDVENFTPSAKVATATTATPATA
SAAIPTVIPVGVEVTEEVKNSQMRKTIAKRLAESKFTAPHYYLAIEIDMDNAMESRAQIN
NLPDTKISFNDMVVKACAMALKKHPQVNTSWKGDTTLYNKHVNVGVAVAIEDGLVVPVIK
FTDTLTLTQIGALVKDLAGKARNKKLTPAEMEGSTFTVSNLGMFGVDVFTSIINQPNSAI
LSVGAIVEKPVVKNGQIVVGHTMQVTLACDHRTIDGATGAQFLQTLKAYIENPVTMLA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattattactatgccacgcttgagcgacactatggaagagggtgttgtagca
aagtggcttaaaaaagtaggcgataaagtaaatgaaggcgatatcttagcagaaatcgag
acggataaagctacaatggaatttgaatcattccatacaggaaccttattgtatataggt
ttaaaagaaggagaaagtgctaaagtagataccttattggctatcataggtaaagagggt
gaagatatttcggcacttatagctggaggagctcaagcatcggctcctaaagctgaagaa
gctaaacctgttgctgaggtaactacggctcctgttgctggtgctactataccagcagga
gtagaagtggtaacaatgcctcgactcagtgatacaatgacggaaggtactgtggcttct
tggctcaaaaaggtaggtgatactgtaaaagaaggtgatatcttagctgaaattgaaacc
gataaggctacaatggagtttgaatcattttactcaggtactttattgtatataggttta
aaagaaggagaaagcgcagcagtagattcattattggcgattataggccctgcgggtact
gatgtgaacgcagttttggcagccgtgaaagctggcggagcttcaacttcggctccttca
actcctaaggctgaaagcaaaccggctgaaacagccacatcagctactacttcggtagct
aatgcaaacgaccgcgtatttgcttctcctttggctaagaaaatagcacaagataaaggt
attaaccttactgaggtgaaaggaacaggtgaaaatggacgtattgtgaagaaagacgta
gaaaactttacaccaagtgctaaggttgctacggctactacggctacacctgcaaccgct
agcgcagctatcccaactgtaattcctgtgggagtggaagtaactgaagaggtgaaaaac
tcacaaatgcgcaaaacgattgcgaaacgtttggcagaatctaaatttactgcacctcac
tactatttggcaatagaaattgatatggataacgcgatggaatctcgcgctcaaatcaac
aatttgccagacaccaaaatatctttcaacgatatggtagtgaaagcctgcgcaatggca
cttaaaaaacaccctcaagtaaatacttcttggaaaggcgataccaccctttacaacaag
cacgtgaatgtaggggtggctgtggctattgaagatggcttggtagtacctgttatcaag
tttacggatactttaacgcttactcaaataggcgccttggtaaaagacttggctggtaag
gcacgcaacaagaaacttactcctgccgaaatggaaggaagtactttcactgtgtctaac
ttgggtatgtttggggtagatgtatttacttctatcatcaatcagcctaactctgctatt
ctttcagtaggagctattgttgagaaacctgtagtgaaaaacggacaaatagtagtaggt
cacactatgcaagtaactcttgcttgcgaccaccgtactatcgacggggctactggagct
caattcttacaaacactcaaagcttatattgagaatcctgtaacaatgctcgcataa

DBGET integrated database retrieval system