KEGG   Capnocytophaga ochracea: Coch_0063Help
Entry
Coch_0063         CDS       T00961                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
coc  Capnocytophaga ochracea
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Coch_0063
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Coch_0063
Enzymes [BR:coc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Coch_0063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
83219..85558
Genome map
AA seq 779 aa AA seqDB search
MKIKLTSALLLLITIISCKSTTNNQGESTANYEVIPLPEMITTPQADADKPFVLTADTKI
TYPEGDASLQQYAGFLQEYIKKQAGIEVNITPNQNNETNTIALLQNYQNNNKEAYQVVVN
AKNITVNGASKAGTFYGVQLLRKSIPVQKVGKVIFPAKEITDKPYFAYRGAHLDSARHFF
NADSVRIYIDMLALHNINKFHWHLTDDQGWRFESKKYPELTVVGSTRSQTMVNKQWDTFD
GKPHGGFYTQQEMKDIVKYAADRNITVIPEIDLPGHMVAALATYPQLGCTGGPYKVRETW
GIAEDVLCAGNPETYDFIKNILEEVTEVFPSEYIHIGGDECPKDSWKKCPKCQAKIKELG
IKGDAKHTAEEYLQSHIITFAEDVLAKKGRKIIGWDEILEGGLAPNATVMSWRGIGGAIE
AAKSNHDAIMTPVSYCYFDYYQTDKTDKEPLAIGGYVPVERVYSFNPYPDALNKEQQKHI
LGVQANVWTEYIKTFKHVQYMVLPRFAALAEVQWEDPAKPKDYNQFLQRLMRLLPIYQLE
GYNYAKHIFDLRAEVKPEVGDIQVTLSCLQDTPIYYTTDGSEPTKSSNVYKEPLKLTQDT
HLKAKVFGQETESSFEQQFLFNKATVRPIEFLSKPSYNYTFGGAITLVDGRKGGTNSRSG
EWLGFSEAPCEVVITLKENTPVKEVRFNALIETGDWIYPPTSFEVSGSKDGKSYDLLAKE
NYALPKEPLKEIKTYSLSFPEKEVTYLKVKINGVNKIPSFHQGAAGKPGFLFIDEIQVL
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgaagataaaattaacttccgcacttttgttattgataacgattatttcgtgtaaatca
actacaaacaatcaaggagagagtactgctaattatgaggtaattccactacccgaaatg
attaccactccccaagctgatgccgataaacctttcgtgcttacggctgataccaaaatc
acctatccagaaggtgatgcttctttacagcagtacgctggattcttgcaagagtatatc
aaaaaacaagcaggaattgaagtgaatatcactcctaaccaaaacaatgagaccaacact
attgccttgttgcaaaattaccaaaacaacaacaaagaggcttaccaagtagtggtgaat
gccaagaacattactgtaaatggagcttctaaagcgggtactttctatggagtacaactc
ttgagaaaatccattccggtacaaaaagtaggcaaagtcatcttccctgccaaagaaata
accgataaaccctatttcgcttatcgtggtgcacatttagatagtgcccgtcactttttt
aatgccgactctgtgcgcatttatatcgatatgttagcactccacaatatcaataaattc
cattggcatctcaccgatgatcaaggttggcgttttgaatctaaaaaataccccgaactt
actgtggtaggaagcactcgtagccaaactatggtaaacaaacagtgggacaccttcgat
ggtaaacctcacggaggcttctatactcagcaagaaatgaaagacattgtaaaatatgcc
gccgaccgcaatattaccgttattcctgagatagacctcccaggacatatggttgctgct
ttggctacttatccacaattaggctgtacaggaggcccttataaagtaagagaaacttgg
ggcatagccgaagatgtactttgtgctggcaaccccgaaacttatgatttcattaaaaat
atattagaagaagtaactgaagtattcccttcagaatatatccatataggaggtgacgaa
tgtcctaaagatagctggaagaaatgccctaaatgccaagctaagataaaagagttaggt
attaaaggtgatgctaaacacacagccgaagaatacttacaaagtcacataattacattc
gctgaagatgtattagctaaaaaaggtcgcaaaatcattggttgggacgaaatccttgaa
ggaggtttagctcctaatgctactgtaatgtcttggagaggtatcgggggcgctatagaa
gcagccaagtctaaccacgatgctattatgacccctgtttcttattgctacttcgactat
tatcaaacagataaaaccgataaagaacctcttgctattggtggttatgtaccggtagaa
cgtgtttactctttcaatccttaccccgatgcgcttaataaagaacaacaaaaacacatc
ttaggagtacaagccaatgtttggacagagtatatcaagactttcaaacacgtacaatat
atggtattgcctcgttttgcagccttagccgaagtacaatgggaagaccctgcaaaacct
aaagactacaatcagtttttacaacgcttaatgcgcttacttcctatctaccagttagaa
ggttataactatgctaaacacatattcgatcttcgtgccgaagtaaaacctgaggtaggt
gatatacaagtaacactctcttgtttacaagacacacctatctattacactaccgatggg
agtgaacctactaagagttctaacgtgtataaagaacctttaaaactcactcaagataca
catctaaaagctaaagtattcggtcaggaaaccgaaagtagcttcgaacaacagttcctt
ttcaacaaagcaaccgtacgccctattgagttcctcagtaaacctagttacaactatact
tttgggggcgctattaccttagttgatggtagaaaagggggtactaattcacgctctgga
gaatggttaggttttagtgaagcaccttgtgaagtggtgattaccctaaaagaaaatact
cctgtaaaagaagtgcgcttcaatgctcttattgaaacaggtgattggatttaccctcca
accagctttgaagtatcggggtctaaggacggtaaaagttatgatttactcgctaaagaa
aactatgcgcttcctaaggaacctctcaaagaaataaaaacttactctctttctttccct
gaaaaagaagtaacctatctaaaagtgaagataaatggagtaaacaaaattccttctttc
catcaaggagcagctggtaaacctggtttcctcttcatcgatgaaattcaagtattgtaa

DBGET integrated database retrieval system