KEGG   Capnocytophaga ochracea: Coch_0086Help
Entry
Coch_0086         CDS       T00961                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
coc  Capnocytophaga ochracea
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:coc00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:coc00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
106725..108035
Genome map
AA seq 436 aa AA seqDB search
MGVFKIEGGHTLKGSITPQGAKNEALQVLCAVLLTDQKVTIHNIPDIQDVNKLISLLENL
GVKIQKLGKGTYSFQADDINIDYLKSEAFHTEGQALRGSIMIVGPLLTRFGVGYIPKPGG
DKIGRRRLDTHFEGFIKLGAHFEYDENNFTYSVVAKKLKGSYMLLEEASVTGTSNIIMAA
VLAEGTTTIYNAACEPYVQQLCRMLNAMGADIQGIGSNLITINGVERLEGCTHTILPDMI
EIGSWIGLAAMTRSEITIKNVGWEHLGIMPTIFQKLGITFEKKNDDIHIPAHTNGYEIQN
YIDGSILTVADAPWPGFTPDLLSIVLVVATQARGEVLIHQKMFESRLFFIDKLIDMGAKI
ILCDPHRATVIGNDFRSPLRATLMTSPDIRAGIALLIAALSAKGTSTIYNIEQIDRGYEN
IDGRLKALGAQIVRVS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtttttaaaatagaaggtggacataccctcaaaggaagtatcacaccacaagga
gctaaaaacgaagcactacaagtactttgtgcggttttactcaccgaccaaaaagttacc
attcacaacattcccgatattcaagatgtgaataaactgatttctttgctcgagaattta
ggcgtcaaaatccaaaagctcgggaaaggtacttatagctttcaagccgacgatatcaat
atagactatttaaagtccgaggcttttcataccgaagggcaagccctgcgaggttctatt
atgatagtaggccctctgctcacgcgttttggagtaggctatattcctaaaccgggaggt
gataaaataggtcgccgtcgcctcgacacccacttcgaagggttcatcaaattaggtgcc
cacttcgaatatgatgagaataactttacttatagcgtagtagccaagaaactaaaagga
agctatatgcttttagaagaagcctcagttacgggtacttccaatattattatggctgcc
gtattagccgaaggtactacaactatttataacgcagcttgcgagccctatgtacaacaa
ctctgccgtatgctcaacgctatgggagccgatatacaaggtatcggttccaacctcatt
actatcaacggggtagaacgcttagagggttgtacacacactatcctccccgatatgatt
gaaataggtagttggataggcttggctgctatgacccgcagtgaaattaccattaagaat
gtaggctgggagcatttgggtattatgcctactatcttccagaaattaggtattaccttc
gaaaagaaaaacgacgatattcatatccccgctcatactaacggctatgaaatccaaaat
tatattgatggctctatcctaaccgtagctgatgccccttggcctggttttacccccgac
ctactcagtatcgtcctggtagtcgctacccaagcacgtggggaagtgcttattcaccaa
aagatgtttgagagtaggctattctttatcgataaactcatagatatgggtgctaaaatt
atactatgcgaccctcaccgcgctaccgttatcggtaatgatttccgttcacctttgcgc
gcaaccctaatgacctcgcctgatattcgtgctggtatagccttgcttattgcagctctt
tcagccaaaggcacctctaccatttacaatatagaacaaatagaccgtggttacgaaaac
atcgacggacgactcaaagccctcggtgcccaaatagtaagagtttcctaa

DBGET integrated database retrieval system