KEGG   Capnocytophaga ochracea: Coch_0100Help
Entry
Coch_0100         CDS       T00961                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
coc  Capnocytophaga ochracea
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Coch_0100 (tpiA)
   01230 Biosynthesis of amino acids
    Coch_0100 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Coch_0100 (tpiA)
   00051 Fructose and mannose metabolism
    Coch_0100 (tpiA)
   00562 Inositol phosphate metabolism
    Coch_0100 (tpiA)
Enzymes [BR:coc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Coch_0100 (tpiA)
Exosome [BR:coc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Coch_0100 (tpiA)
  Exosomal proteins of bladder cancer cells
   Coch_0100 (tpiA)
  Exosomal proteins of melanoma cells
   Coch_0100 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
121122..121871
Genome map
AA seq 249 aa AA seqDB search
MRKKIVAGNWKMNNDLNKSLALISDLLKKVPQTNAEVMIAPTFVNLIPAVEAVKGSHIEV
IAQNMHFAENGAYTGEISAEMLGSIGVKTTILGHSERRAYFNETDESLAKKVNTALKHNM
RVVFCIGEELADRKANKHFDVVGSQIKNGLFHLPAEAWQHIVLAYEPVWAIGTGETATPD
QAQEIHHFIRKTIADKYGKGVADKVSILYGGSVKPDNAKEIFAKEDVDGGLIGGAALKAD
DFVTIIKSI
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaaattgtagcagggaactggaaaatgaacaacgaccttaacaagtcgtta
gcacttatttccgacctattgaaaaaagtacctcaaacaaatgctgaggtaatgattgcc
cctacctttgtaaaccttattccagctgtagaagcagtaaaaggtagccacatcgaagta
attgcgcaaaatatgcactttgctgaaaacggtgcttacacgggagagatttcggctgaa
atgttaggcagtattggggtaaaaactactattttaggacactctgagcgccgcgcttac
tttaacgaaactgatgagagtttagctaaaaaagtgaacacagcccttaaacacaatatg
cgtgtagtgttctgtattggtgaagagttagctgaccgcaaagctaataagcactttgat
gtggtaggtagccaaatcaaaaatggtttgttccacttgcctgctgaggcttggcaacat
attgtattggcttacgaacctgtatgggctattggtacaggcgaaaccgctactcctgac
caagcacaagaaattcaccactttattcgtaaaactattgctgacaaatacggcaaaggg
gttgctgataaagtatctatcttgtatggaggtagtgtaaaaccggataatgcaaaagaa
atctttgcaaaagaagatgtagatggcggactcataggtggggctgcccttaaagctgat
gattttgttactattatcaaaagcatttaa

DBGET integrated database retrieval system