KEGG   Capnocytophaga ochracea: Coch_0100Help
Entry
Coch_0100         CDS       T00961                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
coc  Capnocytophaga ochracea
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:coc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:coc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:coc00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:coc00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
121122..121871
Genome map
AA seq 249 aa AA seqDB search
MRKKIVAGNWKMNNDLNKSLALISDLLKKVPQTNAEVMIAPTFVNLIPAVEAVKGSHIEV
IAQNMHFAENGAYTGEISAEMLGSIGVKTTILGHSERRAYFNETDESLAKKVNTALKHNM
RVVFCIGEELADRKANKHFDVVGSQIKNGLFHLPAEAWQHIVLAYEPVWAIGTGETATPD
QAQEIHHFIRKTIADKYGKGVADKVSILYGGSVKPDNAKEIFAKEDVDGGLIGGAALKAD
DFVTIIKSI
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaaattgtagcagggaactggaaaatgaacaacgaccttaacaagtcgtta
gcacttatttccgacctattgaaaaaagtacctcaaacaaatgctgaggtaatgattgcc
cctacctttgtaaaccttattccagctgtagaagcagtaaaaggtagccacatcgaagta
attgcgcaaaatatgcactttgctgaaaacggtgcttacacgggagagatttcggctgaa
atgttaggcagtattggggtaaaaactactattttaggacactctgagcgccgcgcttac
tttaacgaaactgatgagagtttagctaaaaaagtgaacacagcccttaaacacaatatg
cgtgtagtgttctgtattggtgaagagttagctgaccgcaaagctaataagcactttgat
gtggtaggtagccaaatcaaaaatggtttgttccacttgcctgctgaggcttggcaacat
attgtattggcttacgaacctgtatgggctattggtacaggcgaaaccgctactcctgac
caagcacaagaaattcaccactttattcgtaaaactattgctgacaaatacggcaaaggg
gttgctgataaagtatctatcttgtatggaggtagtgtaaaaccggataatgcaaaagaa
atctttgcaaaagaagatgtagatggcggactcataggtggggctgcccttaaagctgat
gattttgttactattatcaaaagcatttaa

DBGET integrated database retrieval system