KEGG   Capnocytophaga ochracea: Coch_0238Help
Entry
Coch_0238         CDS       T00961                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
coc  Capnocytophaga ochracea
Pathway
coc00480  Glutathione metabolism
coc00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Coch_0238
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Coch_0238
Enzymes [BR:coc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Coch_0238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA SCO1-SenC Redoxin
Motif
Other DBs
NCBI-ProteinID: ACU91801
JGI: Coch_0238
UniProt: C7M5J1
Position
complement(310706..311218)
Genome map
AA seq 170 aa AA seqDB search
MENLQAQNNADNQTIYQFTVEDINGKPFVLADLKGKKVMIVNTASKCGLTPQYKELEALY
KQYKDKDFVIIGFPANNFLGQEPGSNEQIASFCSINYGVTFPMMSKISVKGKNMHPLYQF
LTQKSKNGVEDSKVKWNFQKYLIGRDGKLEKVIDPKTLPSSDEVIQWIEK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatctacaagctcaaaacaacgctgataatcaaactatttatcagtttactgta
gaagatatcaatggcaaaccctttgtccttgccgacctcaaaggcaagaaagtaatgatt
gttaatactgcgtcaaaatgcggtctcactccccaatacaaagagcttgaagccctctat
aagcagtataaagacaaagattttgtcattataggattccccgctaataatttcttaggg
caagaacctggtagtaatgaacaaattgcttcattttgcagtatcaactatggagtaaca
ttcccgatgatgagcaaaatatcggtaaaaggaaagaatatgcaccctctatatcagttt
cttacacaaaaatcaaagaacggagtagaagattctaaagtaaaatggaattttcaaaaa
tacctcattggcagagatggcaagttagaaaaggtaatcgaccctaaaactttaccatcc
agtgatgaagtaatacaatggattgaaaaataa

DBGET integrated database retrieval system