KEGG   Capnocytophaga ochracea: Coch_0243Help
Entry
Coch_0243         CDS       T00961                                 

Definition
heavy metal translocating P-type ATPase
Orthology
K01533  
Cu2+-exporting ATPase [EC:3.6.3.4]
Organism
coc  Capnocytophaga ochracea
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(315686..318187)
Genome map
AA seq 833 aa AA seqDB search
MEYNIEGMGCRGCANTIQKKLSEVAGVTAVTVDFATKKATVETDREIPFEALEKALEGTH
YSIHQASNSEGSGVFYCPMHCEGDKTYDHPGDCPICGMHLVEQVGGAQQQHHHHEETPKK
AKGSGVFYCPMHCEGNKTYDHPGDCPVCGMDLVEQVSTEAPEGESAEEQKRKKLRRHFWG
AVAFTLPIFIIAMIGMWHNNPLYELMPVSAWNWVQFALSLPVVFYFCWIFFERAWRSIRT
LHFNMFTLIGIGAGVAWLFSVVGLLVPDMFPEQFKEHGSVHLYFEAATVILTLVLLGQVL
EADAHSRTQGAIKKLLNLAPNEATKIVHGEEIRVSIEEVTLGDLLRVKPGEKIPVDGVIT
EGSASIDESMITGEPIPAEKEVGSKVSAGTLNGAQSFVMKAEKVGSDTLLSQIVQLVQQA
SSSRPPIQNLADKIASYFVPIVIGISVLTFVIWSVFGGENAYVYALLNAVAVLIIACPCA
LGLATPMSVMVGVGKGAQNGILIRNAEALEVMNKVNTLVIDKTGTLTEGKPSVSEVFTFG
NRSEKDLLQVLYSLNQHSEHPLAKATNAYTQAQGATPLSFTNFEALAGRGVKASYEGKNF
FFGNERLMEEIGAPLSEEIQTVVKTAQAAGKTVSLLAIEKEIIGVVTITDRVKTSTVQAL
QELQDLGVEIVMLTGDNSLTAAAIAKEIGISNYKAGMLPQNKQAEVARLQAEGKIVAMAG
DGINDAPALAQANVGIAMGTGTDIAIESAEITLVKGDLNGIVKAKKLSKAVMKNIHENLF
FALVYNVVGIPVAAGVLYPIFGILLSPMLGALAMSFSSVSVISNALRLRRTKL
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atggaatacaatatagaaggtatggggtgcagaggttgtgccaataccatacaaaaaaag
ctctctgaagtagcaggcgtaacagctgttaccgtagatttcgctactaaaaaagctact
gtcgaaactgatagagaaatcccttttgaagctcttgaaaaagccttagagggtactcat
tatagcattcatcaggcttcaaattctgaaggctctggtgttttctattgtcctatgcac
tgcgaaggcgataaaacctacgatcaccctggtgattgccctatatgtggtatgcacttg
gtagaacaagtaggaggagctcaacaacaacatcatcaccacgaagaaaccccaaaaaaa
gccaaaggctctggtgttttctattgtcctatgcactgcgagggcaacaaaacctacgac
caccccggtgattgccccgtatgtggtatggatttagtagagcaagtaagcacagaggct
cctgaaggtgaaagtgcggaagagcaaaagcgcaaaaagttacgccgtcacttttggggt
gctgtagcctttacgctccctatctttatcatcgcaatgatcggaatgtggcacaacaat
ccgctgtatgagttaatgcccgtaagtgcttggaactgggtgcagtttgcgctttcttta
ccagtagttttctatttctgctggatattcttcgaaagggcttggcgcagtatccgcacc
ttgcacttcaatatgtttacccttatagggataggcgctggtgtagcttggcttttcagt
gtagtaggactgttagttcctgatatgttccctgaacaattcaaagaacacggctcagta
cacttgtatttcgaagctgctaccgtcattctcactttggtactcttagggcaagtgctc
gaagccgatgcccacagtcgtacgcaaggggctatcaaaaaactgttgaatttagcccct
aatgaggctactaaaattgttcacggcgaggaaataagagtctctatagaagaagtaacc
ttaggcgatttgttgcgagtgaaacctggtgagaaaatccccgttgatggtgtaattacc
gaaggtagtgcgagcatagatgagagtatgattacgggcgaacctattcctgctgaaaaa
gaagtaggcagtaaagtgtcggcaggtacgctcaacggtgctcaatcatttgtgatgaaa
gcggaaaaggtaggtagcgataccctgctctctcaaatcgtacagttggtacaacaagcc
agcagtagccgtcctcccattcaaaatttagccgacaagatagcctcttactttgtgcct
attgtgatagggatttcagtgcttacctttgtgatatggtcggtttttggaggtgaaaat
gcttacgtatacgccctgctcaatgccgtagcagtattgattatcgcttgtccttgtgca
ctcggtttagccacccctatgtcggtaatggtaggcgtaggcaaaggagctcaaaacggt
atcttgatacgcaatgctgaagccttagaagtgatgaacaaagtaaacacattagtcatc
gacaaaacaggcacacttactgaggggaaacccagtgtgagcgaagtatttacctttggc
aacagaagtgaaaaggatttgttacaagtgctctatagtctcaatcagcacagtgaacac
cctttagcaaaagctaccaatgcatacactcaagcacaaggtgctactcccctatccttt
actaactttgaagccttggcgggcagaggggtaaaagcctcttacgaaggaaaaaatttt
ttctttggcaatgaacgattgatggaagaaatcggtgctcctttatccgaagaaatacaa
actgtggtaaaaacagcgcaagcagcaggaaaaaccgtttcacttctcgccatagaaaaa
gaaatcattggggtagtaaccatcaccgatagagtaaaaacctctactgttcaagcctta
caagagttgcaggacttgggagtagaaattgtaatgcttacaggcgataattcgcttaca
gctgcagctattgccaaagaaataggcatcagcaactacaaagctggtatgctccctcaa
aacaaacaagctgaagtagcgcgtttgcaagctgaaggaaaaatcgtagcaatggcaggc
gatggtatcaacgatgctcctgctttggcacaagctaacgtaggcatcgcaatgggcacc
ggtactgatatcgctatagaaagtgctgaaatcaccttagtaaaaggcgatttaaatggt
attgtaaaagctaaaaaactcagcaaagcagtaatgaaaaacatacacgaaaacctattt
tttgctttggtatacaacgttgtaggtatccccgttgctgcaggagtgctataccctatt
tttggtatcttgctttctcctatgttgggtgccttagcaatgagctttagctctgtaagt
gttataagtaatgctttaagattgagaagaacgaaattataa

DBGET integrated database retrieval system