KEGG   Capnocytophaga ochracea: Coch_0277Help
Entry
Coch_0277         CDS       T00961                                 

Gene name
eno
Definition
(RefSeq) phosphopyruvate hydratase (EC:4.2.1.11)
  KO
K01689  
enolase [EC:4.2.1.11]
Organism
coc  Capnocytophaga ochracea
Pathway
Glycolysis / Gluconeogenesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Coch_0277 (eno)
   01230 Biosynthesis of amino acids
    Coch_0277 (eno)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Coch_0277 (eno)
  Energy metabolism
   00680 Methane metabolism
    Coch_0277 (eno)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Coch_0277 (eno)
Enzymes [BR:coc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     Coch_0277 (eno)
Messenger RNA biogenesis [BR:coc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Coch_0277 (eno)
Exosome [BR:coc04147]
 Exosomal proteins
  Proteins found in most exosomes
   Coch_0277 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
357315..358607
Genome map
AA seq 430 aa AA seqDB search
MSIIVSVHARQILDSRGNPTVEVDVMTENGFLGRAAVPSGASTGEYEAVELRDGGKNYMG
KGVLKAVANVNDIIAEEIVGMDVFEQNLIDKTMIELDGTPNKSKLGANAILGVSLAVARA
AAEELGLPLYRYVGGVSAHTLPVPMMNIINAGAHSDAPIAFQEFMIMPVNAKNFSQAIQM
GSEVFHNLKKVLHKKGLSTAVGDEGGFAPNFKDIEDALDSIKEAVKEAGYKWGEDIKIAL
DCASSEFYKNGKYDYTIFEGAKGKVRTSAEQAEYLAELVAKYPIISIEDGMDQNDWDGWK
LLTDKLGKKVQLVGDDLFVTNVSILERGIAKGIANSILIKVNQIGTLSETIAAVDMANRA
GYTAVMSHRSGETEDNTIADLAVALNTGQIKTGSASRSDRMAKYNQLLRIEESLGSVAYY
PKEKAFNVKN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagtattattgtaagcgtgcacgcacgtcagattttggattcaagaggaaatccaacc
gtagaagtagatgtaatgaccgagaatggtttccttggtagagctgctgttccatcagga
gcatcgacaggtgaatacgaagccgttgaattgcgcgacggtggtaaaaattatatgggt
aaaggcgtactcaaagccgttgctaatgtaaacgatatcatcgctgaagaaatcgtaggt
atggacgttttcgaacaaaaccttatcgacaaaacaatgattgagcttgacggtactcct
aacaaatctaaattaggagctaacgctattcttggggtatcattggcagtagcaagagcc
gctgctgaagaactcggtttgcctttgtaccgttatgtaggtggggtaagtgctcacact
ttgcctgtaccaatgatgaacatcatcaacgctggggcacactccgatgcgcctattgct
ttccaagagtttatgattatgcctgtgaacgctaagaacttttcacaagctatccaaatg
ggttcagaagtgttccacaaccttaaaaaggtattgcacaaaaaaggattgagcactgcc
gtaggtgatgaaggaggttttgctcctaactttaaagacatcgaagacgctctcgattct
attaaagaagctgtaaaagaagcaggctacaaatggggtgaagatatcaaaatcgcctta
gactgtgcttcttctgagttctacaaaaatggcaaatacgattatactatctttgaaggt
gctaaaggtaaagtacgcacttcagctgaacaagctgagtacttggcagaattagtagct
aaataccctatcatctctatcgaagacggtatggatcaaaacgactgggacggatggaaa
ctccttactgacaaattgggcaaaaaagtacaattggttggtgacgatttgttcgttact
aacgtatctatccttgaaagaggtattgccaaaggtattgccaactctattctcatcaaa
gtaaaccaaatcggtactttgtctgaaactatcgcagccgtagatatggcaaaccgcgct
ggttatactgccgtaatgtctcaccgttcaggagaaacagaagacaacactattgccgac
ttagcagtagctttgaacaccggacaaatcaaaacaggttcggcttcacgttctgatcgt
atggcgaagtacaaccaattgctccgcatcgaagaatctttgggttcagtagcttactat
cctaaagaaaaagccttcaatgtaaagaactaa

DBGET integrated database retrieval system