KEGG   Capnocytophaga ochracea: Coch_0277Help
Entry
Coch_0277         CDS       T00961                                 

Gene name
eno
Definition
phosphopyruvate hydratase (EC:4.2.1.11)
Orthology
K01689  
enolase [EC:4.2.1.11]
Organism
coc  Capnocytophaga ochracea
Pathway
Glycolysis / Gluconeogenesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:coc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:coc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:coc00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:coc00680]
Genetic Information Processing; Folding, sorting and degradation; RNA degradation [PATH:coc03018]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
357315..358607
Genome map
AA seq 430 aa AA seqDB search
MSIIVSVHARQILDSRGNPTVEVDVMTENGFLGRAAVPSGASTGEYEAVELRDGGKNYMG
KGVLKAVANVNDIIAEEIVGMDVFEQNLIDKTMIELDGTPNKSKLGANAILGVSLAVARA
AAEELGLPLYRYVGGVSAHTLPVPMMNIINAGAHSDAPIAFQEFMIMPVNAKNFSQAIQM
GSEVFHNLKKVLHKKGLSTAVGDEGGFAPNFKDIEDALDSIKEAVKEAGYKWGEDIKIAL
DCASSEFYKNGKYDYTIFEGAKGKVRTSAEQAEYLAELVAKYPIISIEDGMDQNDWDGWK
LLTDKLGKKVQLVGDDLFVTNVSILERGIAKGIANSILIKVNQIGTLSETIAAVDMANRA
GYTAVMSHRSGETEDNTIADLAVALNTGQIKTGSASRSDRMAKYNQLLRIEESLGSVAYY
PKEKAFNVKN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagtattattgtaagcgtgcacgcacgtcagattttggattcaagaggaaatccaacc
gtagaagtagatgtaatgaccgagaatggtttccttggtagagctgctgttccatcagga
gcatcgacaggtgaatacgaagccgttgaattgcgcgacggtggtaaaaattatatgggt
aaaggcgtactcaaagccgttgctaatgtaaacgatatcatcgctgaagaaatcgtaggt
atggacgttttcgaacaaaaccttatcgacaaaacaatgattgagcttgacggtactcct
aacaaatctaaattaggagctaacgctattcttggggtatcattggcagtagcaagagcc
gctgctgaagaactcggtttgcctttgtaccgttatgtaggtggggtaagtgctcacact
ttgcctgtaccaatgatgaacatcatcaacgctggggcacactccgatgcgcctattgct
ttccaagagtttatgattatgcctgtgaacgctaagaacttttcacaagctatccaaatg
ggttcagaagtgttccacaaccttaaaaaggtattgcacaaaaaaggattgagcactgcc
gtaggtgatgaaggaggttttgctcctaactttaaagacatcgaagacgctctcgattct
attaaagaagctgtaaaagaagcaggctacaaatggggtgaagatatcaaaatcgcctta
gactgtgcttcttctgagttctacaaaaatggcaaatacgattatactatctttgaaggt
gctaaaggtaaagtacgcacttcagctgaacaagctgagtacttggcagaattagtagct
aaataccctatcatctctatcgaagacggtatggatcaaaacgactgggacggatggaaa
ctccttactgacaaattgggcaaaaaagtacaattggttggtgacgatttgttcgttact
aacgtatctatccttgaaagaggtattgccaaaggtattgccaactctattctcatcaaa
gtaaaccaaatcggtactttgtctgaaactatcgcagccgtagatatggcaaaccgcgct
ggttatactgccgtaatgtctcaccgttcaggagaaacagaagacaacactattgccgac
ttagcagtagctttgaacaccggacaaatcaaaacaggttcggcttcacgttctgatcgt
atggcgaagtacaaccaattgctccgcatcgaagaatctttgggttcagtagcttactat
cctaaagaaaaagccttcaatgtaaagaactaa

DBGET integrated database retrieval system