KEGG   Capnocytophaga ochracea: Coch_0399Help
Entry
Coch_0399         CDS       T00961                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
coc  Capnocytophaga ochracea
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Coch_0399
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Coch_0399
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Coch_0399
Enzymes [BR:coc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Coch_0399
Exosome [BR:coc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Coch_0399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
505927..507336
Genome map
AA seq 469 aa AA seqDB search
MKRRAFFKRGALAALGGLVLPSFDLQAQTLGEAHKNKRTKNIIFMVSDGMSFGTLVMADL
YLKRKFGRPSSWIGLYESNLAQRAVMDMASASSVVTDSSAASSSWGGGVRVKNGSLNISP
DGKENMPILQKFKKAGKKVGCITTVMVNHATPAGFCTWSKSRNAMDEIALNYTELGFDVM
LGGGSKYFDPAHRKDKKDLFAVLKKKGYTVARTRGEMLKAPTNKPLYGLFAEDALPYSID
RAQSSEEQAKSPTLAEMTAKAIDQLKSHPNGFVIQVEGGKVDWAAHGNDIGALLYDQVAF
DEAIKVALDFAKADGNTLVVLTSDHGNANPGLIYGKECNNNFDRLQNFTHSNDWILQQIN
SNDSVAKVREHVAQYCGGMNISEEQAKELLSYYAKTERKEDGLYNYKHLPYRLFAEIQKA
HTSVGWISMDHSSDYTELAMYGPGSERLKPFMRNTDMHNFLLEAAEVRV
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaagagcattttttaaacgtggggctttagcagctttaggaggcttagtattg
ccttcctttgatttacaagcgcaaacccttggggaagcccataaaaacaaacgcactaaa
aacatcatctttatggtgagtgatggtatgagtttcggcactttggtaatggctgacctg
tatctaaaacgcaaattcggtcgcccttccagctggataggattgtacgaaagtaacctc
gcacagcgcgccgtaatggatatggcatcagcaagttcagtagtcaccgactcctcagca
gcgagttcgtcttggggcggtggcgtacgtgtaaagaacggtagcctaaatatcagtcca
gatggcaaagagaatatgcctatcttgcaaaagttcaaaaaagcaggcaagaaagtgggt
tgtatcactaccgtaatggtaaaccacgccactccggcaggcttctgtacgtggagtaaa
agtcgtaatgctatggacgagatagccctcaactacaccgaattaggcttcgatgtgatg
ttgggtggcggtagcaaatacttcgaccctgcccatcgcaaggacaagaaagacctcttt
gctgttctcaaaaagaaaggttatacggtagctcgcactcgcggtgaaatgctgaaagca
cctactaataaacctctctatgggctctttgctgaagatgcactcccctactctatcgac
cgtgctcaaagcagtgaagaacaagctaaatcgcctactcttgcggagatgaccgctaag
gctatcgaccaacttaaaagtcaccctaatggctttgtaatacaagtagaaggcggcaaa
gtagactgggcggcacacggcaatgatataggggctttgttgtacgaccaagtagctttt
gacgaggctataaaagtagccctcgattttgcaaaagctgatggcaacactcttgtagtg
cttacttctgaccacggcaatgccaaccctggactcatctatggcaaagagtgtaacaac
aattttgacagattacaaaacttcacccattctaacgactggatattgcaacaaatcaac
tctaacgactcggtagccaaagtgcgtgagcacgttgctcaatactgcggtggaatgaac
atcagtgaggaacaagctaaagaactcttaagctattatgctaaaaccgaaagaaaagaa
gacggcttgtacaactacaaacacctgccttaccgattgtttgccgaaatacaaaaagca
catacttcggtaggctggataagtatggatcactcatcggattacaccgaattggcaatg
tatgggccaggtagcgagcgacttaaaccttttatgcgcaataccgatatgcacaatttc
ttgttggaggcagcggaggttagagtttag

DBGET integrated database retrieval system