KEGG   Capnocytophaga ochracea: Coch_0445Help
Entry
Coch_0445         CDS       T00961                                 

Definition
glucan endo-1,6-beta-glucosidase (EC:3.2.1.75)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
coc  Capnocytophaga ochracea
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Coch_0445
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Coch_0445
Enzymes [BR:coc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Coch_0445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
567337..568842
Genome map
AA seq 501 aa AA seqDB search
MKIFPSFLLIILWSIASCSCQKKNNTGEEPTPPPVVEPSVGKVSVLLTTGNRQKEFYKEQ
TDLKLIKNPNASYSITLKPAEKFQTIYGFGAAITGSTCYNLMQMSPADRKAFLTETFSET
EGFGQNFVRISIGCSDFSLSEYTLCDTKGIEHFVLTKEETEYVIPILKEILAINPKVQII
GSPWTPPRWMKVNNLTNLQPHNQWTSGQLNPAHYQDYALYFAKWLQAMKDNGLNVNAITI
QNEPLNRGNSASMYMGWDEQLAFIKNALGKTLRDKGFAEVKIYLFDHNYNYDNKPSQQQY
PLHIYKDADASQYVTGAAYHNYGGNPNELSNIHNQYPNKELIFTESSIGTWNDGRNLERR
LTEDMQELGIKTLNNHCKAVIVWNLMLDEHGAPNREGGCKTCFGAVDIQTSDYKTMRRNS
HYYVIGHLSAVIKQGATRIGVEKTPDDNVQCTAFENPDGSLACVLLNKKKETTYLTLSTG
KQYFSYEVPANSVVSFLIPKI
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattcccatcttttttacttataatactctggagcatcgcttcttgtagctgt
cagaaaaaaaacaacacaggggaggaacctactcctccccctgttgttgagccatcggta
ggtaaagtgagcgtattgctaaccacaggcaatcgccaaaaagaattctacaaagagcaa
accgacctaaagctcatcaaaaaccctaatgcatcttatagtatcactctaaaacctgct
gaaaaatttcaaactatctatggtttcggggctgccattacaggttctacctgctataac
ttgatgcagatgtcccccgccgatagaaaggcgttcctcaccgaaaccttctccgaaact
gaaggttttgggcagaattttgtgcgtatatccattggctgttccgacttttctctaagt
gaatacaccctttgcgataccaagggaatagagcattttgtcctcaccaaagaggaaact
gagtacgtgattcctatactcaaagagattctcgctatcaaccccaaagtgcaaatcata
ggctctccttggacacctccacgctggatgaaggtcaataaccttaccaatttgcaacct
cataaccaatggacaagcggtcagctaaaccctgctcactatcaggattacgcgttgtac
ttcgctaaatggttgcaagcgatgaaagacaatggattgaatgtcaatgctatcactata
caaaacgaacctctcaacagaggcaactcggcttctatgtatatgggatgggacgagcaa
ctcgcttttatcaaaaacgccttaggtaaaaccctgcgtgacaaaggctttgctgaggtt
aaaatctacctcttcgaccataactacaactacgataataagccttcacaacagcaatac
cccttgcatatctataaagatgccgatgcctctcagtacgttacgggggctgcttaccat
aactatgggggaaatcctaacgaattgagcaacattcataaccaatacccaaataaagaa
ctcattttcactgaaagctccataggtacttggaacgatggtcgcaatcttgaacgccgt
ctcaccgaagatatgcaagagctcggtatcaaaaccctcaacaatcattgcaaggcggtg
attgtatggaatttaatgctcgacgagcacggagcgcccaatcgtgaaggcggttgcaaa
acttgttttggtgcggtcgatatccaaacatccgattataaaacgatgcgtcgcaactcg
cattactacgtgataggtcacctttcggcagtcatcaagcagggagcaacccgcataggt
gttgagaaaacccccgacgacaacgtgcaatgtaccgcattcgagaaccctgacggctct
ttggcttgtgtgttgttgaataaaaagaaagaaacaacctatctgaccctaagcaccggc
aagcagtatttctcttatgaagtacccgccaatagtgtggtatcttttttgatacctaaa
atataa

DBGET integrated database retrieval system