KEGG   Capnocytophaga ochracea: Coch_0487Help
Entry
Coch_0487         CDS       T00961                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
coc  Capnocytophaga ochracea
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Coch_0487
   00670 One carbon pool by folate
    Coch_0487
Enzymes [BR:coc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Coch_0487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
625290..625784
Genome map
AA seq 164 aa AA seqDB search
MITLIAAVAENNAIGKGDQLLWHLPEDFKHFKRLTTGHCIIMGRKTFETFPKPLPNRIHI
VITRQKGYAKEGAVVVSSVEEAIEKALAIDPNPYVIGGGEIYAQALLFADAIELTRVHHT
FAEADVFFPEFNREEWELVASERFEKDERHAYGFTFERYVVTRS
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgataactcttatagctgctgttgccgagaataatgctattggcaaaggagaccaactg
ttatggcatttgcctgaagattttaagcatttcaaacgcctcacgacgggacactgcatt
ataatgggacggaagaccttcgagactttccccaaacctttgcctaaccgtatacatatt
gttattacgcgccagaaagggtatgcgaaagagggagctgtggtggtttcttcagttgaa
gaggctatagaaaaggctttggcaatagaccctaacccttacgtgataggcggtggagaa
atctatgcacaagccctcctctttgccgatgcgatagaactcacacgggtacatcacact
tttgccgaagctgatgtattctttcctgagtttaaccgtgaagaatgggagttagtagcc
tctgagcgttttgaaaaagacgaacggcacgcttatgggtttacttttgaaagatacgtt
gtaacacggtcgtag

DBGET integrated database retrieval system