KEGG   Capnocytophaga ochracea: Coch_0990Help
Entry
Coch_0990         CDS       T00961                                 

Definition
alpha amylase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
coc  Capnocytophaga ochracea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Coch_0990
Enzymes [BR:coc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Coch_0990
Exosome [BR:coc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Coch_0990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1158364..1160328)
Genome map
AA seq 654 aa AA seqDB search
MNDPLLLPYLPVIQGRHQHFIDVLHRVQGDAKCLADACNSHLYYGLHRTHTEWVLREWAP
NATAIFLLCDSNDWQKNKHYSFTKLNDQDWELRVPANILRHEMLYKLLVEWEGGSGERLP
SHTTRAVQDDYTKVFSAQVWCPEHPYPWQHPRPKATPHPLIYEAHIGMSTEHQRVSTFIE
FRLYVLPRIAALGYNTIQLMAIQEHPYYGSFGYQVANFFAVSSRFGTPEELKELIDAAHG
LGIRVLLDIVHSHSVSNEAEGLSHFDGTDYLYFHRGERGKHPAWDSRCFDYGKPQVLNFL
LSNCKYWLEEYRFDGFRFDGVTSMIYYDHGLGKAFTDYSFYYDGNEDDDALVYLTMANQL
IHELYPEALTIAEEMSGLPGLASPIAEKGIGFDYKLSMGIPDYWIKLLKEVPDEQWHVGN
IYYELTNKRAEERTISYAESHDQALVGDKTIFFWLTDKEVYTGMSVFDHSLIIDRAMALH
KMIRLVTLGTAGGGYLNFMGNEWGHPEWIDFPRQGNNWSYAHARRLWSLVDDSNLKFKYL
NAFDSAMIHFATDSKFLDREPHILVRDIERQLLIFERSGYLFVFSFNPTTSYTDYQFDVP
AGKYTTILNTDNPAFGGDNRIDESVEHFTQYTGKENLLSLYIPARIGIVLKIDN
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacccactattgctaccatacctccctgttattcagggaaggcatcagcacttt
atcgatgtccttcatagagtgcaaggggacgctaagtgcctggctgatgcttgtaattcg
cacctctactacggtctgcaccgtactcatacagaatgggtgctacgcgagtgggctcca
aatgcaacggctatctttcttctttgcgatagcaacgactggcaaaaaaacaaacactat
tctttcactaaactaaacgaccaagactgggaattgcgtgttcctgctaatatcctccgc
cacgaaatgctctacaaactacttgtggaatgggaaggaggcagtggcgaacgcctcccc
tcacatactactcgtgccgtgcaggacgactataccaaggtgttttctgcccaagtgtgg
tgccccgagcacccctacccttggcaacacccacgccccaaagctactccacatccactt
atctacgaagcacatatagggatgagtaccgaacaccagcgcgtgagtacttttatagag
tttcgcctctatgtactgccccgtatcgcagccttgggctataacacaatccaactgatg
gcaatacaagagcacccttactacggctcttttggctatcaggtagctaacttctttgcg
gtgagttcacgctttggcacccccgaagaactcaaagaactcatcgatgctgcgcacggc
ttgggcatacgtgtactgcttgatattgtacactcgcattcggtgagcaacgaggcagaa
gggctcagccacttcgacggtaccgactatctttacttccaccgcggtgagcgcggtaaa
caccctgcttgggactcccgctgttttgactatggtaagccccaagtactgaatttttta
ctttctaactgtaagtattggttagaagaatatcgcttcgacggtttccgcttcgacggg
gttactagtatgatttattacgatcacggtttaggcaaagcctttaccgattatagtttc
tattatgatggcaatgaggacgacgacgctttggtgtatcttactatggctaaccaactt
attcacgagctctaccccgaagcgctgaccattgccgaagagatgagcggattgcccggt
cttgcttcgcctattgctgaaaaaggcataggcttcgattacaagctgagtatgggtatt
cctgattattggattaagctccttaaagaagtccccgatgagcagtggcacgtaggcaat
atctattacgaattgactaacaaacgcgccgaagaacgcaccatcagttatgccgaaagc
cacgaccaagccttggtgggtgataaaacgatatttttctggcttactgataaggaagtg
tataccggaatgagcgtattcgaccacagtctcatcatcgaccgtgcgatggctttgcac
aagatgatacgtttggtaactcttggtaccgcaggtgggggatacctcaactttatgggc
aacgaatggggacaccctgagtggattgactttcctcgccaaggcaacaactggagttat
gcacacgcacgcaggctatggagtttggtagacgactctaacttaaagtttaaatacctc
aacgcttttgatagcgcgatgatacactttgctaccgatagtaagttcctagaccgagaa
ccccatatattggtgcgcgacatcgagcgacagctactcatattcgagcgcagtgggtac
ttatttgttttcagcttcaaccccaccacctcctacaccgattatcagtttgatgtgcca
gcaggcaagtacaccaccatactcaacaccgataaccccgcctttggaggtgataaccgc
atcgatgaaagcgtagagcattttacgcagtacaccggcaaggagaatttgctgtcgttg
tatatacccgcgagaattggaatagtattaaaaattgacaattga

DBGET integrated database retrieval system