KEGG   Capnocytophaga ochracea: Coch_1016Help
Entry
Coch_1016         CDS       T00961                                 

Definition
glycoside hydrolase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
coc  Capnocytophaga ochracea
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Coch_1016
  Lipid metabolism
   00600 Sphingolipid metabolism
    Coch_1016
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Coch_1016
Enzymes [BR:coc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Coch_1016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1194534..1196951)
Genome map
AA seq 805 aa AA seqDB search
MLLWLAHPIYGQAIREHILLDNGWKFSLGHATDPTKDLFYRVYNDFSKTLSKGINFSSID
YDDSAWQTVDLPHDWAVTLPFSEKGDWSHGYKALGSTFPEHSIGWYRKTFDLSKSEAGKR
IELQFDGIFRDSRCWVNGIYVGHHLSGYTGIKYDITDLVHFGKPNVITVRVDATQNEGWF
YEGAGIYRHVWLNSYNSVHSSPEEVFIYTKSIGKQAEMHAEATVHNRETSSQTFQVEWSI
LNREKKVIATHKSANTTFAPNEKVTVKSNLNIPNAQLWDTEHPYLYTLTTKIISNGKTTD
LIHTRFGVRTFSYQPDGFYLNGKKMKIKGVCVHQDHAGVGTALLDELQYYRIGLLKAMGA
NAYRTAHHPHSPAVLQACDSLGLLVMDETRLLNSGREYRQQFEDLIKRDRNHASVFMWCI
GNEEEKIQSTETGERIARTLVSLQQHLDPSRVSTYGANVGNENEGVSAAIPVRGFNYNLY
GLTDYEKTHPNQPIIGTEVASTVGTRGVYLPEIVLDKAGGYSGHFVADTLRAYLLDQDKS
YPSWASQAQQWYSTTANDPRFMGGFVWTGFDYRGEPTPFAWPNISSHFGVMDVCGFPKNV
YYYYKAHWSESPILHIAPHWNLNLPQGTVVKVWVYSNTEEVELFLNGKTLGKQKTPAFGH
LYWEVPYEKGTLKAVGTKNGKRITSEITTTEKPFAIVLSPHKTQLKAGKQDAVVVNVSVV
DKKGREVPNADALIQFQLTGDARIIGVGNGDPSSHEKDTFAEGERVERKLFNGKCQVIIR
SGEKGGKVQLRAISNGLKEAVVRMN
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgctcctatggcttgctcaccccatctatgggcaagccattagggagcatatattgtta
gataacggttggaaattcagcttagggcacgctaccgaccctactaaagatttgttttac
cgcgtgtataacgacttctctaaaacactttccaaaggcattaacttttcgagcatagac
tacgacgatagcgcgtggcaaaccgtagacctccctcacgattgggcagtaactctccct
ttcagtgaaaaaggcgattggtctcacggatataaagccttaggcagtaccttccccgag
catagtattggttggtatagaaaaacctttgacctcagcaaatccgaagcaggcaaacgc
atcgaactgcaattcgacggtatttttagggacagtcggtgttgggtaaatggcatttat
gtagggcatcacctcagcgggtatacaggaataaagtacgatattaccgatttggtgcat
tttggcaaacccaacgtgattaccgtaagggtagacgctacccaaaacgaaggttggttt
tacgaaggcgcaggtatctatcgacacgtgtggctaaactcttacaactctgttcactct
tcccccgaagaggtttttatctataccaaaagcattggcaaacaagccgaaatgcacgcc
gaagccactgtgcataaccgagaaacaagctcacaaacttttcaggtggaatggagtatt
cttaatcgtgaaaagaaagtaatagctactcacaaatctgcaaatactacttttgcccct
aatgaaaaagtaactgtaaagagtaaccttaacattcctaatgcacagctttgggacact
gagcacccctatctgtataccttaacaacgaaaatcatttccaacggaaagaccaccgac
cttattcacacccgctttggggtgcgcacttttagttatcaacccgacggcttttacctc
aacggcaaaaaaatgaaaataaaaggcgtgtgcgtacatcaagaccacgccggagtaggt
actgcactattagacgaattgcagtattatcgtattgggttactcaaagcaatgggcgcc
aatgcctaccgcactgcccatcaccctcatagccctgccgtgctacaagcctgcgacagt
ttgggtttattagtgatggacgaaacccgactcttaaacagcggaagagaataccgtcaa
caatttgaagaccttatcaagcgcgaccgcaatcacgctagcgtatttatgtggtgtatc
gggaatgaagaagaaaaaatacaaagtaccgaaactggcgagcgcatcgctcgtacgttg
gtgagtttacaacagcatttagacccttcacgcgtgagcacttatggcgccaacgtaggt
aatgaaaatgaaggtgtgagtgctgccatacctgtacgaggcttcaattacaacctctat
gggcttaccgactatgaaaaaacacaccctaatcaacctatcatcggcaccgaagtagcc
agcaccgtgggtactcgaggggtgtatctgccggaaatcgtacttgacaaagcagggggg
tacagtggtcattttgtagccgataccctacgcgcttacctgctcgaccaagacaagagt
taccccagttgggcatcacaagcacagcaatggtacagcacgactgctaacgaccctcgt
tttatgggaggtttcgtatggacgggcttcgactatcgcggagagcctaccccttttgcg
tggcctaatatcagttcgcattttggggtaatggacgtgtgtggtttccctaagaacgtg
tattactactacaaagcccattggagtgaatcgcctatattgcacatagcccctcattgg
aatctgaacctgccccaaggcactgtggtaaaagtgtgggtatatagcaataccgaagaa
gtggaacttttcttgaacggaaagacgctcggtaaacaaaaaacacctgcttttggacac
ttatattgggaagtaccctacgaaaaaggtacgctgaaagccgtaggcactaagaatgga
aagcggattacctccgaaataactactaccgaaaaaccttttgcgattgtgctttctcct
cataaaacacaactgaaagccggtaagcaagatgccgtagtggtgaatgtgagtgtagta
gataaaaaaggacgtgaagtacctaatgccgatgcccttatacagtttcagcttacagga
gatgctcgcattataggagtaggaaacggcgaccccagttcgcacgagaaagatactttt
gccgaaggagagcgtgtagagcgtaaactctttaatggcaaatgccaagtgattatccgc
tcaggtgaaaaaggtggaaaggtacaactacgcgctataagtaacggactgaaagaggcg
gtggtgagaatgaattaa

DBGET integrated database retrieval system