KEGG   Capnocytophaga ochracea: Coch_1097Help
Entry
Coch_1097         CDS       T00961                                 

Definition
(GenBank) hypothetical protein
Organism
coc  Capnocytophaga ochracea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CarbopepD_reg_2 CarboxypepD_reg
Motif
Other DBs
NCBI-ProteinID: ACU92652
JGI: Coch_1097
UniProt: C7M497
Position
complement(1297534..1298364)
Genome map
AA seq 276 aa AA seqDB search
MNKSFLLFFCMFSFISYSQKTLKNTIKDEKGTPIEYVNIGIVGTHKGTISDAHGNFSLEK
LQPKPTDSIYFSHISYERRAICIKDFQNDKPIVLTEKEIMLAPIDVSAKTKQLKTLKGKG
IRFVGAILYYTPEDMKTQEEFPETIGDFVNLKTNWVATEFHITCIKNNTEKAVFRLNFFQ
MNNQEMSPLTEKPIYITIPKTESKIDVVEKFRVPIPKGKIWIELQPIDIQGEEKARIVFP
ASRSLGYARYDTTFEKIPLGAGLSFAIKGYEYEVVE
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatcatttttattattcttttgtatgttttctttcatttcttatagtcaaaaa
acattgaagaatactataaaagatgaaaaaggcactcccatcgaatacgtaaacatcggt
attgtgggcactcacaaaggtacaattagtgatgcacacggcaatttctccttagaaaag
ttacagcccaagcctactgatagtatttacttttcacatattagttacgaaagaagagct
atttgtataaaagactttcagaatgataaacctattgtccttacagaaaaagaaataatg
cttgcgcctatagatgtttcagcaaaaacaaagcagctaaaaactttaaagggaaaagga
attcgttttgtaggggctatcctatattatacgcctgaagatatgaaaacgcaagaggaa
tttcctgaaactattggtgattttgtgaatcttaaaaccaattgggtagctacagaattt
cacattacttgtatcaaaaataataccgagaaagcagtctttcgtttaaacttttttcag
atgaacaatcaagaaatgagtcctcttactgaaaaacctatctatatcactattcctaaa
acagaaagtaaaatagacgtagtggagaaattcagagttcctatcccaaaaggaaaaata
tggatagaattacaacctatagacatacaaggagaggaaaaagctcgcattgttttccca
gcttcacgttctttaggctatgcacgctacgatacaacttttgagaaaattcctttgggt
gcaggactttcttttgccataaaagggtatgaatacgaagttgtagaataa

DBGET integrated database retrieval system