KEGG   Capnocytophaga ochracea: Coch_1244Help
Entry
Coch_1244         CDS       T00961                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
coc  Capnocytophaga ochracea
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Coch_1244
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Coch_1244
Enzymes [BR:coc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Coch_1244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1453315..1453863
Genome map
AA seq 182 aa AA seqDB search
MKVIRTKIEGVVIIEPQVFFDGRGYFFESFSQQRFNELVSPTVFVQDNESQSTYGVLRGL
HFQKPPFAQAKLVRVVKGEVLDVAVDLRKDSPTFGQYESVILNEENKRQFFIPRGFAHGF
AVLSEEAIFQYKCDNYYAPESEGSVRWDDPTIGIDWRLPAEVIQLSEKDKKAPLLVEAKG
KR
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaatcagaactaagatagaaggcgtggtgattattgagccacaggtgtttttt
gacggaagaggttacttttttgaatcgttttcgcaacagcgatttaatgagttagtaagc
cccactgtatttgtacaagacaacgaatcgcaatcgacctatggggtattgcgcggatta
cactttcagaaaccaccttttgcacaggctaaattggtgagagtcgtaaaaggagaagta
cttgatgtagcagtggatttgcgaaaagactcacctacctttgggcagtatgagtctgtg
atactaaacgaagaaaacaagcgccagttttttatcccgagaggttttgctcacggtttt
gctgtattgagcgaagaagctatttttcaatacaaatgcgacaattactacgctcccgag
agtgagggtagtgtgcgctgggacgaccctaccataggtatcgattggcgactaccagct
gaggtgatacaactttcggagaaagacaagaaagcgccattactggtagaggcaaaaggt
aaaagataa

DBGET integrated database retrieval system