KEGG   Capnocytophaga ochracea: Coch_1273Help
Entry
Coch_1273         CDS       T00961                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
coc  Capnocytophaga ochracea
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Coch_1273
Enzymes [BR:coc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Coch_1273
Exosome [BR:coc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Coch_1273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1482745..1483731
Genome map
AA seq 328 aa AA seqDB search
MYPLRRNRRLRVNDTVRSLVKETIVTPDDFLVPLFVVEGTGVKEEIASMPGYYRYSLDLL
TKEVKELWSLGLKSVLLFVKVPDALKDNKGVEAANPNGLMQRAIKTVKEAVPQMLVMTDV
ALDPYSIYGHDGIVENGRIVNDATVNALCTMALSHAQAGADFIAPSDMMDGRILALRETL
EDNSFEHVGIMAYSAKYASAFYGPFRDALDSAPVDQQDIPKDKKTYQMDYHNRLEALRET
RMDIEEGADIVMVKPGLCYLDIVREVKNMSEVPVAVYQVSGEYAMLKAAAANGWLDHDAV
MMEQIVSIKRAGADLIASYFAKEVVKLL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtatccactgagaagaaaccgccgtttgcgcgtaaacgatacggtacgtagtttggta
aaagaaacgattgttacccccgatgattttcttgtacctctctttgtagttgaaggtact
ggcgtaaaagaagaaatagcctctatgccgggttattaccgttatagcctcgacctatta
acaaaagaagtaaaagagctttggagcttaggactcaaatcggtattactgtttgtgaaa
gtgcctgacgctcttaaagacaacaaaggcgtagaagcagccaaccctaatggcttgatg
caacgcgctattaaaactgtgaaagaagcagtgccccaaatgctcgtaatgactgatgta
gcactcgacccttattccatttatggtcacgatggcattgtggaaaacggacgcattgtg
aacgatgctactgtaaatgctctttgtacaatggcactctcacacgctcaggcaggtgct
gatttcatcgcgcccagcgatatgatggacggacgtatcctcgccttgcgtgaaaccctt
gaagacaatagctttgagcacgtagggataatggcttatagtgccaagtacgcctcagct
ttctacggacctttccgcgatgcactcgacagtgctcccgtagaccaacaggatatccct
aaggataagaaaacttaccaaatggactatcacaaccgcctcgaagctttacgcgaaacc
cgtatggatatagaggaaggtgctgatattgtgatggtaaaaccagggctttgctattta
gacatcgttcgcgaggtgaagaatatgagcgaagtgcccgtggctgtttaccaagtatcg
ggtgaatacgcaatgctgaaagctgctgctgccaacggttggctcgatcacgatgctgta
atgatggaacaaattgtgagcatcaagcgtgctggtgccgaccttatcgctagctatttt
gctaaggaagtcgtaaaacttttatag

DBGET integrated database retrieval system