KEGG   Capnocytophaga ochracea: Coch_1285Help
Entry
Coch_1285         CDS       T00961                                 

Definition
alpha-glucan phosphorylase (EC:2.4.1.11 2.4.1.1)
Orthology
K16153  
phosphorylase / glycogen(starch) synthase [EC:2.4.1.1 2.4.1.11]
Organism
coc  Capnocytophaga ochracea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Coch_1285
Enzymes [BR:coc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Coch_1285
    2.4.1.11  glycogen(starch) synthase
     Coch_1285
Glycosyltransferases [BR:coc01003]
 Polysaccharide
  Storage polysaccharide
   Coch_1285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1496745..1500986)
Genome map
AA seq 1413 aa AA seqDB search
MSNTKKINPDYVFETSWEVCNKVGGIHTVITTKAPSIAKQFRRKYILIGPDIWQHNENKE
FVENPELFKSWRAKAASEGLRVRVGNWKIEGNPIVILVDFSHYVSAKNEILRYYWDNYKL
DSYNSPWDYVESVLFGYAVGKVIESFVKFNTASRENVICHFHEWMTGSALLYLEEEMPKI
GSVFTTHATVVGRAIAGNGYPLYNDMKNYKPEEMAYRFGVQHKHFLEKETTKVADCFTTV
SEITAQEALHFLSRKTDIITPNGFNDAIVPAEKDFDKKRAEAKQRLISVAQALVTQPISK
DTKIVAISGRYEFRNKGIDAFIDALGALNRNSNNKKELLAYILIPTAHDAPNQGLLNNLH
NPQQTTENEQKHLTHILPDVYHDVIMTRIYEQQLFNRKEDKVKVIFCPSYLNGNDGVFNL
SYYDLLIGLDGTAFPSYYEPWGYTPLESLAFKVPTITTTLAGFGKWVNDYYPEKQKAIEV
VPRTDSNYGEVVGAIAKNIQNLLDRKEQDFQELRETAGKVSEIALWKNLVQYYIKCYELT
LENIEDRVESLPPVETDGVAYLEKSKVVNTPNWRSVIIHRAIPEALQPLEELAKNLWWCW
NDEAYEVFKYIDKAQWIEVRKNPIALLDSISLTRYKELEQDAVFMRNLSKVYGDFQAYMA
KKSEMVSPSISYFSMEYGLHSSLKIYSGGLGILAGDYLKEASDKATKITGVGLLYRYGYF
TQKLSSAGNQEADYEAQDFSKIPVTPVTDESGKWLIISIDLPGRTLYARVWRVDVGRIEL
YLLDTDFENNREDDRSITHHLYGGDWENRLKQEMLLGLGGIKMLRKLGIDSDIYHCNEGH
AAFIGLERLSEYIQNENLTFSEAMEVVRASSLFTTHTPVPAGHDAFEEGLLRAYLGNYAD
ILHVNWEQILALGKINLQNPHEKFSMSNLAANLSQEVNGVSWLHGEVSKEILKDLWPGYM
PEELHVSYVTNGVHQPTWTAGLWKEVENEVFGKDYKTHHYDPKSFEGIYKVSDQRVWEIK
TALRSKLLRRVEQKLRLEKNTPYFSPRQLVEIKENLREDILTIGFARRFATYKRAHLLFT
NIERLDKIVNNPERPVQFIFAGKAHPADKAGQDLIKNIVEISKLPQFLGKILFVPNYDME
LARHMVQGVDVWMNTPTRPLEASGTSGEKAAMNGVMHFSVLDGWWVEGYREDAGWALPME
RSYENQQYQDEMDAETIYNIIEDEIAPIFYDKNKDGISSRWCALIKNTIAKVAVNFTTTR
MLTDYEKQYYYPMTERVTKIKDNHFAIAIELSNWKRKVTQEWDNIKVVSFKVPNRNEQLI
SIGKVYKGEITLELGELRPEDVGVELVVAQHKDDKFKVLSTSEFTVVAQEGNKATYQLEI
ASEYPGALHLAIRIFPKNNLLPHRQDFALVKWL
NT seq 4242 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatacaaagaaaattaatcccgactatgtgtttgaaaccagttgggaagtatgt
aacaaagtaggaggtattcacacagtgattaccacaaaagctccgagtattgcgaaacaa
ttcagaaggaaatacattctgattggtcccgatatttggcaacacaacgaaaataaagaa
tttgtagaaaaccccgaactcttcaaatcgtggcgtgctaaagcagcttctgagggcttg
cgcgtgcgtgtggggaattggaaaatagaaggcaaccccatagtaattctcgtagatttc
tctcattatgtaagtgctaaaaacgagattttgcgctattattgggataactataagctc
gattcttacaacagtccgtgggattacgtagagtcggtgctttttggttatgcagtaggg
aaggtgattgagagctttgtgaagttcaacactgcttcacgcgaaaacgtgatttgccat
ttccacgaatggatgaccggtagtgcgctactctatttggaagaagaaatgcctaaaata
ggttcggtattcactactcacgctaccgtagtaggtcgtgcgattgccggcaatggttat
ccgctctacaacgatatgaagaactacaaacccgaagaaatggcctatcggtttggggta
caacacaagcacttcctcgaaaaagaaactaccaaagtagccgattgcttcactacggta
agcgaaattactgcccaagaagcgttgcacttcctcagtagaaaaactgatatcatcacg
cctaatggcttcaacgacgccatagtaccagctgaaaaagattttgataagaagcgtgca
gaagctaaacagcgtcttatcagcgtagcacaggctttggtaacccaacctattagcaag
gataccaaaattgtagctatcagcggtagatatgagttccgcaacaaaggtatcgatgcc
tttattgatgccttgggagcactgaataggaattctaataacaagaaagagcttttggct
tacatcttaattcctacagctcacgatgcgcctaaccaaggattgctaaacaatttgcac
aaccctcagcaaactaccgaaaacgaacaaaagcaccttacccatattctccctgatgtg
tatcacgatgtgataatgactcgtatttatgagcaacagctcttcaataggaaggaagat
aaggtaaaagtgattttctgtccaagttatctcaatggcaacgacggggtgttcaacctt
tcttattacgacttgctcatcgggttagacggcaccgctttcccatcgtactacgagcct
tggggctatacaccgcttgaaagtttagcttttaaagtacctaccattaccactactttg
gcaggttttggcaagtgggtgaacgattattaccccgaaaaacaaaaagcgatagaagta
gtaccgcgcactgatagcaactacggtgaggtagtaggcgcaattgctaagaatattcag
aatttattagacaggaaagaacaagacttccaagagcttcgcgaaacagcaggtaaagta
tcagaaatcgctctgtggaagaacttagtacaatactacataaaatgttatgaactcact
cttgaaaatatagaggacagagtggagagtctgcctccggtagaaactgatggagtggca
tatttagagaaatcgaaggtggtgaacacgcctaactggcgcagtgtgattatccaccgt
gcaattccagaagccttgcaaccgctcgaagaactcgctaaaaacctttggtggtgctgg
aatgacgaggcttacgaagtttttaaatacatagataaagcccaatggatagaagtgcgt
aaaaaccctattgccttgctggacagcatctcacttactcgttataaagaattggagcaa
gatgcggtatttatgcgcaatctttcgaaagtatatggtgatttccaagcctatatggct
aagaaatcggagatggtaagtccgtctatctcttattttagtatggaatacggcttacat
tcttccttgaagatttattcaggaggtttgggtatcttggcaggcgattacctaaaagaa
gccagcgacaaggcaaccaaaatcactggagtagggttgttataccgctatggttatttc
actcaaaaactatcctcagcaggtaaccaagaagccgactacgaagcacaagatttctcg
aagataccggtaacgcctgtaacagatgagagtggaaaatggttgattatatcaatagat
ttaccaggtagaaccctatatgcacgtgtatggcgtgtggacgtaggtcgtatagagctt
tatcttctcgacaccgattttgagaacaaccgcgaagacgaccgttctatcacccaccac
ttatatggaggcgactgggaaaaccgtcttaaacaagaaatgttattaggtttaggaggt
attaagatgttgcgcaagctaggtatcgacagtgatatttaccactgcaacgaagggcac
gctgcctttatagggttggaacgcctcagcgagtatatccaaaacgagaaccttactttc
tcggaagcgatggaagtggtgcgcgcttcatcgctctttactactcacaccccagtaccc
gcaggtcacgatgcttttgaagaaggcttattacgcgcttatttaggaaattacgccgat
atattgcacgtgaattgggaacaaatactcgctttgggtaaaataaacttgcaaaaccca
cacgagaaattctcgatgagtaacctcgcagcgaacctttcgcaagaagtaaacggtgtg
agctggctacacggtgaggtaagtaaagaaatcctcaaagacttgtggccaggttatatg
cccgaagaacttcacgttagctatgtaaccaatggggtacaccaacctacgtggacagct
ggcttgtggaaagaagtagaaaacgaggtgtttggcaaagactacaaaacacatcactac
gaccctaagagctttgagggcatctataaggtatctgaccaacgcgtgtgggaaatcaaa
acggctcttcgttctaagctcttgcgccgtgtagaacaaaagctgcgtttagagaagaac
accccttatttctctccacgtcagttagtggaaatcaaagagaacttacgcgaagatatc
cttaccattggttttgcacgtcgttttgcgacctacaaacgcgctcatttgctctttacc
aatatagagcgtttggataaaatagtgaacaatcctgagcgtcctgtacagttcatcttt
gcagggaaagcccaccctgccgataaagcaggacaggatttgattaagaatattgtggaa
atctctaaattaccacagttcttaggtaagatattattcgttcctaactacgatatggag
ctcgcgcgccatatggtacaaggagtagatgtatggatgaatacccctacacgtccgcta
gaagcctcaggaaccagtggtgaaaaagctgcgatgaacggggtaatgcacttcagcgta
cttgatggttggtgggtagaagggtatcgggaagatgccggttgggctctccctatggaa
cgctcctacgaaaaccagcagtatcaagacgaaatggatgcagagacgatttacaacatt
attgaagacgagatagctcctatattctatgataagaataaagatggcatctcatcacgc
tggtgtgcactcatcaagaataccattgccaaagtggcggtaaactttaccactactcgt
atgctcactgattacgaaaagcaatactattacccaatgactgagcgcgtaaccaagatt
aaagacaatcactttgcaatcgctattgaactttcgaactggaaacgcaaagttactcaa
gaatgggataatataaaggtagtgagctttaaggtacctaatcgcaatgagcaactcatt
tctattggtaaggtatacaaaggtgaaattaccttagaattaggagaattacgtcctgaa
gacgtaggagtagaattggtagtagcccaacataaagacgataagtttaaagtactctcg
acaagtgagtttacggtagtagctcaagaaggcaacaaagctacctatcaattggaaatt
gcctcagaatatccaggtgctttgcacttagcaataagaattttccctaaaaataattta
ttgccacaccgccaagatttcgctttggtaaaatggctataa

DBGET integrated database retrieval system