KEGG   Capnocytophaga ochracea: Coch_1350Help
Entry
Coch_1350         CDS       T00961                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
coc  Capnocytophaga ochracea
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:coc00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:coc00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1586768..1589095
Genome map
AA seq 775 aa AA seqDB search
MKKLIFSLVTLCLMACKGTEPVIHYEVIPLPQSISYTHQKPFELDAQTVITYPQDDALLQ
RNAQFLASYLKEITGLTLTTEPNVNSGKVIRLKTDLKKPNQEAYQLTVASEQITIDGASP
AGVFYGIQTLRKSIDVTEPKSLAFPTAVIDDAPRFAYRGMHFDVSRHFFTVDFIKQYIDI
LALHNLNKFHWHLTDDQGWRIEIKKYPRLTEVGSTRKETLIGHLLKDKPHQFDGKPYGGF
YTQEQIKEIVKYAQDRYITIIPEVDIPGHTLAVLTAYPELGCTGKDYAVGTKWGVFDDVL
CAGNEASYEFLEGVFDEITELFPSKYIHVGGDECPKTRWKECPKCQAKIKALGLKGDAEH
TAEQKLQGYVVSRVEQFLKKKGREVIGWDEILEGDNISQDAIVMSWRGTEGGIAAAQRHN
RAIMTPHYSLYFDYNQGEDPSKEPLSIGEYLPVKKVYDYEPIDPKLTPEQGKYILGAQAN
LWTEYIASPAHAEYMLLPRLAALAEVQWTAPEKKNYADFLKRLGNLLNYYQKEGYHYAKH
ILGVTPVIQPAPKKDGIQVELLTVGNGKVYYTTDGTTPDATKTLYTQPIKLSNEVLLKAV
AVHKDTISGVFSYQSLFNKATYKPIQLLTETNPKYTFGGATALVDAQIGEDSYIDGHWVG
FPGRVGVEAVIDLGREEEFSTLKAGSLADTPNWIFPASEVAIYSSADGKNFQLITQQPLK
IAQKTDPIKRVPISLNFAKTKTRYVKVVLKGTVIPEWHEGKGTPALLFVDEIQLM
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacttatatttagtttagtaacactatgtcttatggcttgtaaaggcactgag
cctgtaattcattacgaggtaattccgctaccacaatccattagttatacccatcagaaa
ccttttgagctcgatgctcaaaccgtgattacctatccacaagatgatgccttactacaa
aggaatgcccaattcctcgcttcttatcttaaagaaatcacagggctaacccttaccact
gagcccaatgtaaatagtgggaaggttattcgtcttaaaaccgaccttaaaaaacctaac
caagaggcttatcaacttaccgtagcaagtgagcaaattactattgatggagcaagtccc
gcaggtgtgttctacggcatacaaaccttgcgcaagtcgattgacgtaacagaacctaaa
tccttagcgtttcctacggctgtgatagacgatgcgcctcgctttgcctatcggggaatg
cattttgatgtgagcaggcatttctttacagtagattttatcaagcagtacattgatata
ctcgcacttcataaccttaataagttccattggcaccttaccgatgaccaagggtggcgt
atagaaatcaaaaaataccctcgccttactgaggtaggttcaacacgcaaagaaacgctt
attgggcatttgctcaaagataaaccccaccaatttgatggcaaaccttatggtggattc
tacacccaagaacagattaaagagattgtaaaatacgcccaagaccgctatattacgatt
attcccgaggtagatatccccggacataccttagctgtgctcacggcttaccctgagttg
ggttgtacaggcaaggactatgcagtaggtaccaaatggggcgtgttcgacgatgtactt
tgtgccggcaatgaggcttcttatgagttcttagaaggcgtattcgacgaaattaccgaa
cttttcccctctaaatatattcatgtaggaggtgatgaatgtcctaaaacacgttggaaa
gagtgccctaaatgccaggctaaaattaaagcattgggcttaaaaggcgacgctgaacac
actgccgaacagaaactacaaggctatgtggtatcgcgcgtagagcagtttctcaagaag
aaaggtagagaggtaataggctgggacgagattttggagggagataacatttcacaagac
gcaattgtaatgtcgtggcgaggtaccgaaggaggcatcgccgcagcacaacgccacaac
cgtgctattatgaccccgcattacagtttgtatttcgactataaccaaggcgaagacccc
agtaaagaaccactgtccataggtgaatacctccccgtgaaaaaggtgtacgactacgag
cctatcgaccctaaactcactcccgaacaaggtaaatacatcttaggagcacaagctaat
ttatggacagagtacatcgcgagtcctgcacacgctgagtatatgctcttgcctcgcttg
gctgccttagctgaggtacaatggacagccccagagaaaaagaactatgccgactttttg
aagcgtttaggcaacttactcaattactaccaaaaagagggatatcattatgccaaacac
atcttgggcgttacccctgtgattcagcccgctcctaagaaagatggtattcaggtagaa
ctcctcaccgtaggcaatggcaaggtgtactacactaccgatggcactactcctgatgct
accaaaacgctttatacccagcctatcaaactcagcaacgaggtgctgttaaaagcagta
gctgtgcataaagataccataagtggagtgtttagctaccagtcgttatttaataaggct
acttacaagcctatacaattactcactgaaactaatcctaaatacacttttggaggggct
actgccttagtagatgcgcaaataggtgaagattcttatatcgatggacattgggtgggc
tttcctggtcgagtgggagtagaagcagtaatcgatttaggtagagaagaagagtttagt
accttgaaagcgggtagcttagccgatacgcctaactggatatttccagcctcagaagtc
gctatttacagctctgctgatggaaaaaactttcagctcatcactcagcaacctttgaag
atagcccagaagaccgaccctatcaagcgtgtgcctatcagtttgaactttgctaaaact
aaaactcgctatgtgaaagtagtgctcaaaggtactgtaatccctgaatggcacgagggt
aaaggcacaccagccttactatttgtagatgaaatccaattgatgtaa

DBGET integrated database retrieval system