KEGG   Capnocytophaga ochracea: Coch_1515Help
Entry
Coch_1515         CDS       T00961                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
coc  Capnocytophaga ochracea
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:coc00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:coc00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1799957..1801024)
Genome map
AA seq 355 aa AA seqDB search
MITINKSLFGTHNGQAVYQYTLQNANGFRVSVLNLGGTITEIAVKDKHNVLKNVVLGYAH
LEDYIGNGAYNGATIGRTSGRIHNATFTIDGKTYHLFKNNGENSLHGGKEGFSSKLFEVK
ELANGLEMHYTSPDGEEGYPAKVDFKVIYTITEDNSLHIAYEAVADAKTYLNITNHSYFN
LSGDMEMNGDTQVLQIAADNICELAEGLIPTGDYIAVKDTTFDLRKGKVIAEGIAEGHPQ
FEITRAYDHPFVLNHSGLNGAPQLVLHSPHSGITMEAYTTQRVAVIYTGNFLDDVPVFDK
VCTAKEKPSKNPRFVGVAIEMQDFPDGINQPKFGVKPLEKGEVYKQETVYKFLIK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgataaccatcaacaaaagcctgttcggtactcacaacggacaggctgtctatcaatat
accttacagaatgcgaacggctttcgcgtgtctgttttgaacttaggcggtactattacc
gaaatagctgtaaaagataagcacaacgtacttaaaaacgtagtattaggttatgcgcat
ttagaagattacataggtaatggcgcttataatggagctaccatagggcgcacttcaggg
cgtattcacaacgctactttcactatcgacgggaaaacctatcatctatttaaaaataat
ggtgaaaactcattgcacggtggtaaagaaggctttagcagtaaactctttgaagtaaaa
gagctcgctaatggcttggaaatgcactacacaagtcctgatggagaagaaggctaccct
gcaaaagtagatttcaaagtgatttacaccatcactgaagataacagtctgcatattgct
tacgaagccgttgccgatgctaaaacctaccttaatatcaccaaccacagttatttcaac
ctttcaggtgatatggaaatgaatggcgatacccaagtactacaaatcgctgctgataat
atttgtgaattggcagaagggcttattcctacgggtgattacatagctgtaaaagatact
actttcgacctccgcaaaggtaaagttatcgctgagggtattgctgaaggacaccctcaa
ttcgaaatcacacgtgcctacgaccacccctttgtgctcaaccacagcggactcaatggt
gctcctcagttggtattgcattctcctcacagtggtattactatggaagcctatactacc
caacgtgtggctgtgatttacactggtaactttttagatgatgttcctgtatttgataag
gtatgtactgccaaagaaaaaccatcaaaaaacccacgatttgtaggtgtagctattgag
atgcaagatttccccgatggtatcaatcagccgaagtttggggtaaaacccttagaaaaa
ggggaagtgtacaagcaagaaaccgtttataagtttcttattaaataa

DBGET integrated database retrieval system