KEGG   Capnocytophaga ochracea: Coch_1515Help
Entry
Coch_1515         CDS       T00961                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
coc  Capnocytophaga ochracea
Pathway
coc00010  Glycolysis / Gluconeogenesis
coc00052  Galactose metabolism
coc01100  Metabolic pathways
coc01110  Biosynthesis of secondary metabolites
coc01120  Microbial metabolism in diverse environments
coc01130  Biosynthesis of antibiotics
Module
coc_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Coch_1515
   00052 Galactose metabolism
    Coch_1515
Enzymes [BR:coc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Coch_1515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACU93060
JGI: Coch_1515
UniProt: C7M6T4
Position
complement(1799957..1801024)
Genome map
AA seq 355 aa AA seqDB search
MITINKSLFGTHNGQAVYQYTLQNANGFRVSVLNLGGTITEIAVKDKHNVLKNVVLGYAH
LEDYIGNGAYNGATIGRTSGRIHNATFTIDGKTYHLFKNNGENSLHGGKEGFSSKLFEVK
ELANGLEMHYTSPDGEEGYPAKVDFKVIYTITEDNSLHIAYEAVADAKTYLNITNHSYFN
LSGDMEMNGDTQVLQIAADNICELAEGLIPTGDYIAVKDTTFDLRKGKVIAEGIAEGHPQ
FEITRAYDHPFVLNHSGLNGAPQLVLHSPHSGITMEAYTTQRVAVIYTGNFLDDVPVFDK
VCTAKEKPSKNPRFVGVAIEMQDFPDGINQPKFGVKPLEKGEVYKQETVYKFLIK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgataaccatcaacaaaagcctgttcggtactcacaacggacaggctgtctatcaatat
accttacagaatgcgaacggctttcgcgtgtctgttttgaacttaggcggtactattacc
gaaatagctgtaaaagataagcacaacgtacttaaaaacgtagtattaggttatgcgcat
ttagaagattacataggtaatggcgcttataatggagctaccatagggcgcacttcaggg
cgtattcacaacgctactttcactatcgacgggaaaacctatcatctatttaaaaataat
ggtgaaaactcattgcacggtggtaaagaaggctttagcagtaaactctttgaagtaaaa
gagctcgctaatggcttggaaatgcactacacaagtcctgatggagaagaaggctaccct
gcaaaagtagatttcaaagtgatttacaccatcactgaagataacagtctgcatattgct
tacgaagccgttgccgatgctaaaacctaccttaatatcaccaaccacagttatttcaac
ctttcaggtgatatggaaatgaatggcgatacccaagtactacaaatcgctgctgataat
atttgtgaattggcagaagggcttattcctacgggtgattacatagctgtaaaagatact
actttcgacctccgcaaaggtaaagttatcgctgagggtattgctgaaggacaccctcaa
ttcgaaatcacacgtgcctacgaccacccctttgtgctcaaccacagcggactcaatggt
gctcctcagttggtattgcattctcctcacagtggtattactatggaagcctatactacc
caacgtgtggctgtgatttacactggtaactttttagatgatgttcctgtatttgataag
gtatgtactgccaaagaaaaaccatcaaaaaacccacgatttgtaggtgtagctattgag
atgcaagatttccccgatggtatcaatcagccgaagtttggggtaaaacccttagaaaaa
ggggaagtgtacaagcaagaaaccgtttataagtttcttattaaataa

DBGET integrated database retrieval system