KEGG   Capnocytophaga ochracea: Coch_1600Help
Entry
Coch_1600         CDS       T00961                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
coc  Capnocytophaga ochracea
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:coc00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:coc00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1908615..1910075
Genome map
AA seq 486 aa AA seqDB search
MNLKTLLKNITIKTSLYVEDKDITSVCFDSRKAEKGSMFVAITGTQSNGHEYIDQAIRSG
ATAIVCEQLPQQPLPGVSYIVVPNSHSALALIAANFYGNPSEKLILVGVTGTNGKTTIAT
LLYQLFRKAGQKAGLLSTVAVYVDDQCFEATHTTPDPLQLNHYLHLMVEQGVKYCFMEVS
SHGIDQHRTEGLQFAGGIFTNLTRDHLDYHKTFAAYRDVKKRFFDALPATAFALVNNDDK
NGAFMLQNTKAQKKTYALKTHADYKAYIIESRFDGLLLRINQHEVWTKLIGEFNAYNLLA
VYATATLLSIDEIEALTLISAIEPVAGRFQYAVSATGVITIVDYAHTPDALENVLKTIND
IRTHNETLTTVVGCGGNRDKGKRPIMADIATTLSDNVILTSDNPRNEEPETILSEMQQGV
QPQYFHKVQTITDRRQAIQSVCKNAKKGDIILIAGKGHETYQEIKGVRHHFDDFEIVREY
LELYKK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaaaaacattacttaaaaacatcactataaaaacttccctttatgtggaagat
aaagatattacctccgtttgcttcgactctcgaaaggcggaaaaaggaagtatgtttgtt
gccatcacgggtacgcaatctaacggacacgaatacatagaccaagctatacgcagtggc
gcaaccgctattgtatgtgagcaattacctcaacaacctttgcctggtgtaagttatata
gtagtccccaatagtcatagtgctttagccttgattgcagctaacttctatggcaatcct
tctgaaaaacttatcttagtaggcgtaacaggcactaacggaaagactaccattgcaacg
cttctctaccaattgtttagaaaagcaggacaaaaagcggggttgctctccacagtggcg
gtatacgtagacgaccagtgctttgaagcaactcacactacccccgaccctcttcaactg
aatcattatctgcacttaatggtagaacaaggggtgaaatattgctttatggaagtgagc
tctcacggcatcgaccagcatcgtactgaaggactacagttcgcaggaggtatcttcact
aacctcacccgcgaccacctcgattatcacaagaccttcgctgcctatcgcgatgtgaaa
aagcgcttctttgatgcgttacccgctaccgcttttgccttagtaaacaacgatgataag
aatggggcttttatgctacaaaataccaaagcccaaaagaaaacatacgcactcaaaact
cacgcagattataaggcatatatcattgagagcagatttgacggcttgctgttgcgtatc
aatcagcacgaggtatggacaaaactcataggtgagtttaatgcttataaccttttggcg
gtatatgctacagctactctattgagtattgacgaaattgaggctcttactcttatcagc
gccatagaacctgtggcaggacgttttcagtatgcagtatcggctacgggagtgattacc
atagtggattatgctcatacccccgatgcccttgaaaacgttctgaaaaccattaacgat
atacgcactcacaacgagaccctcactactgtagtgggctgtggaggcaatcgcgacaaa
ggtaaacgtcctataatggctgatatagctacaaccctcagcgataatgtaatcctcact
tccgacaatcctcgcaacgaagaacctgagacaattctttccgaaatgcaacaaggggta
cagccacaatactttcacaaagtacaaaccatcaccgaccgtcgtcaggcaatacaatcc
gtttgcaagaatgccaaaaagggagacatcattctcatcgccggtaagggacacgaaact
taccaagaaattaaaggcgttagacaccatttcgacgactttgaaattgtacgggaatac
ttggagctctataagaaataa

DBGET integrated database retrieval system