KEGG   Capnocytophaga ochracea: Coch_1606Help
Entry
Coch_1606         CDS       T00961                                 

Definition
type II L-asparaginase (EC:3.5.1.1)
Orthology
K01424  
L-asparaginase [EC:3.5.1.1]
Organism
coc  Capnocytophaga ochracea
Pathway
Alanine, aspartate and glutamate metabolism
Cyanoamino acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:coc00250]
Metabolism; Metabolism of other amino acids; Cyanoamino acid metabolism [PATH:coc00460]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1915491..1916549
Genome map
AA seq 352 aa AA seqDB search
MMTLMKKIALSLLLMMTVAVFAQQKPKIRILATGGTIAGVSKSNTETNYKAGEIGIYQLL
DAVPEVKNVANVSGEQIVKIGSQDMNDEVWLTLAKRINQLLNKEGYDGVVITHGTDTMEE
TAYFLNLTVHSKKPVVMVGAMRPATGMSADGPLNLYNAVVTAADKNAMGRGVMVCMNDIV
LDAKDVIKTNTTAVETFQGANYGKLAYIHNGKVFFNRTPENKHTYQSVFNVDNLKQLPKV
GIVYSYSNVSELPMKAFMDAKFDGIVHAGVGNGNLYHTIFDLAVKAREQGIQFVRSSRVP
TGATTLDAEVDDAKYQFVASQTLNPQKARVLLMLALTKTKDWKQIQKYFNEY
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgatgacattgatgaaaaaaattgccctctcattgctcttaatgatgactgtagcagtc
tttgcgcaacaaaagccaaagattcgtattttagctactggcggtactatcgctggagta
agtaaatcgaatactgaaaccaactataaagctggtgagatcggtatttaccaactctta
gacgcagtacctgaagtgaagaacgtagccaatgtaagtggtgaacagattgtgaaaatc
ggttcacaagatatgaacgatgaggtatggctcacccttgccaaacgcatcaatcaattg
ctcaacaaagaaggatacgacggagtggtaatcactcacggtaccgatacaatggaagaa
accgcctacttcctcaaccttaccgtacacagcaaaaaacctgtggtaatggtaggagca
atgcgtcctgctaccggtatgagtgccgatggtcctctaaacctctataacgcagtagta
actgctgccgataaaaatgctatgggacgtggagtaatggtttgtatgaacgatattgta
cttgatgctaaagatgtgattaaaaccaatactacagctgtcgaaactttccaaggtgct
aactatggcaaattggcatacattcacaacggtaaggtattctttaatcgtactcctgaa
aacaaacacacttatcaatcagtgtttaatgttgataatttgaaacaattgcctaaagta
ggtatcgtatacagttattctaatgtatctgaattaccaatgaaagcttttatggacgct
aaattcgatggtattgtacacgcaggagtaggtaatggtaacctctatcacactattttc
gatttggcagtaaaagctagagagcaaggcattcagtttgtgcgttcttcacgcgtacct
acaggagcaacaactctcgatgccgaagtagacgatgctaaatatcaatttgtagcttca
caaacactcaacccacaaaaagctcgtgttctattgatgttggcactcactaaaactaag
gattggaaacaaatccaaaaatactttaatgaatattaa

DBGET integrated database retrieval system