KEGG   Capnocytophaga ochracea: Coch_1606Help
Entry
Coch_1606         CDS       T00961                                 

Definition
(GenBank) L-asparaginase, type II
  KO
K01424  L-asparaginase [EC:3.5.1.1]
Organism
coc  Capnocytophaga ochracea
Pathway
coc00250  Alanine, aspartate and glutamate metabolism
coc00460  Cyanoamino acid metabolism
coc01100  Metabolic pathways
coc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Coch_1606
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Coch_1606
Enzymes [BR:coc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     Coch_1606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asparaginase
Motif
Other DBs
NCBI-ProteinID: ACU93151
JGI: Coch_1606
UniProt: C7M771
Position
1915491..1916549
Genome map
AA seq 352 aa AA seqDB search
MMTLMKKIALSLLLMMTVAVFAQQKPKIRILATGGTIAGVSKSNTETNYKAGEIGIYQLL
DAVPEVKNVANVSGEQIVKIGSQDMNDEVWLTLAKRINQLLNKEGYDGVVITHGTDTMEE
TAYFLNLTVHSKKPVVMVGAMRPATGMSADGPLNLYNAVVTAADKNAMGRGVMVCMNDIV
LDAKDVIKTNTTAVETFQGANYGKLAYIHNGKVFFNRTPENKHTYQSVFNVDNLKQLPKV
GIVYSYSNVSELPMKAFMDAKFDGIVHAGVGNGNLYHTIFDLAVKAREQGIQFVRSSRVP
TGATTLDAEVDDAKYQFVASQTLNPQKARVLLMLALTKTKDWKQIQKYFNEY
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgatgacattgatgaaaaaaattgccctctcattgctcttaatgatgactgtagcagtc
tttgcgcaacaaaagccaaagattcgtattttagctactggcggtactatcgctggagta
agtaaatcgaatactgaaaccaactataaagctggtgagatcggtatttaccaactctta
gacgcagtacctgaagtgaagaacgtagccaatgtaagtggtgaacagattgtgaaaatc
ggttcacaagatatgaacgatgaggtatggctcacccttgccaaacgcatcaatcaattg
ctcaacaaagaaggatacgacggagtggtaatcactcacggtaccgatacaatggaagaa
accgcctacttcctcaaccttaccgtacacagcaaaaaacctgtggtaatggtaggagca
atgcgtcctgctaccggtatgagtgccgatggtcctctaaacctctataacgcagtagta
actgctgccgataaaaatgctatgggacgtggagtaatggtttgtatgaacgatattgta
cttgatgctaaagatgtgattaaaaccaatactacagctgtcgaaactttccaaggtgct
aactatggcaaattggcatacattcacaacggtaaggtattctttaatcgtactcctgaa
aacaaacacacttatcaatcagtgtttaatgttgataatttgaaacaattgcctaaagta
ggtatcgtatacagttattctaatgtatctgaattaccaatgaaagcttttatggacgct
aaattcgatggtattgtacacgcaggagtaggtaatggtaacctctatcacactattttc
gatttggcagtaaaagctagagagcaaggcattcagtttgtgcgttcttcacgcgtacct
acaggagcaacaactctcgatgccgaagtagacgatgctaaatatcaatttgtagcttca
caaacactcaacccacaaaaagctcgtgttctattgatgttggcactcactaaaactaag
gattggaaacaaatccaaaaatactttaatgaatattaa

DBGET integrated database retrieval system