KEGG   Capnocytophaga ochracea: Coch_1624Help
Entry
Coch_1624         CDS       T00961                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
coc  Capnocytophaga ochracea
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:coc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:coc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:coc00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:coc00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:coc00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:coc00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:coc00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1938726..1939706
Genome map
AA seq 326 aa AA seqDB search
MSVKKIAVLTSGGDAPGMNAAIRSVVRTCAYHNIEVVGVYRGYQGMIEGDFEEMNARSVR
DIINRGGTILKSARSKDFKTPEGRKAAYEKLKAAGVDSLVVIGGDGSFTGALLFNKEFGF
PVMGIPGTIDNDIYGTDFTLGYDTALNTVIEAIDKIRDTASSHNRLFFIEVMGRDAGHIA
LNSGVGAGAEEILIPEENIGLKKLLESLEKSRRTGKTSSLVVVAEGDKIGKNVFELKEYV
EQHHPDYDVRVSVLGHMQRGGAPSCFDRVLASRMGVKAVESLLEGKSNYMVGIRNNKMEL
TPLEKAIKGSSKIDTELLRVAEIMAT
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaaaaaaaatagcagtattaacatcaggaggagacgctcctggtatgaacgcc
gccattcgttcagtggtacgtacttgtgcataccacaacatcgaagtggtaggtgtatat
cgtggctatcagggaatgatagaaggcgattttgaagaaatgaacgcacgtagcgttcga
gatattatcaatagaggaggtactatcttgaaatcagcccgctctaaagattttaaaact
cctgaagggcgcaaggcagcttatgaaaaattaaaagctgcaggggtagattctttggta
gtaataggaggtgatggctctttcactggggcactcttgttcaacaaagaatttggtttc
cccgtaatgggaatccctggtactatcgataacgatatctatggtactgattttactttg
ggatatgataccgctctcaacactgtaattgaggctatcgacaagattagagatactgca
agctctcacaaccgcttgtttttcatagaagtaatggggcgtgacgcaggacacatcgcc
ttgaactctggagtaggggcaggtgctgaagaaatcttgattccagaagagaatatagga
cttaaaaagctacttgaatctttggaaaaaagtcgtaggactggtaaaacttccagcttg
gtagtggttgctgaaggcgataaaataggtaaaaacgtattcgaacttaaagaatatgta
gagcaacaccaccccgattacgatgtgcgtgtatcagtattagggcatatgcaacgtgga
ggtgctccttcttgcttcgaccgcgtattggcaagccgtatgggggtaaaagcagtagaa
tcactccttgaagggaaatctaactatatggtaggaatccgcaataataaaatggaactc
actccgcttgaaaaagctatcaaaggtagttctaaaatagatacggaactcctccgtgta
gccgaaataatggcaacttag

DBGET integrated database retrieval system