KEGG   Capnocytophaga ochracea: Coch_1624Help
Entry
Coch_1624         CDS       T00961                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
coc  Capnocytophaga ochracea
Pathway
coc00010  Glycolysis / Gluconeogenesis
coc00030  Pentose phosphate pathway
coc00051  Fructose and mannose metabolism
coc00052  Galactose metabolism
coc00680  Methane metabolism
coc01100  Metabolic pathways
coc01110  Biosynthesis of secondary metabolites
coc01120  Microbial metabolism in diverse environments
coc01130  Biosynthesis of antibiotics
coc01200  Carbon metabolism
coc01230  Biosynthesis of amino acids
coc03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Coch_1624
   00030 Pentose phosphate pathway
    Coch_1624
   00051 Fructose and mannose metabolism
    Coch_1624
   00052 Galactose metabolism
    Coch_1624
  Energy metabolism
   00680 Methane metabolism
    Coch_1624
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Coch_1624
Enzymes [BR:coc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Coch_1624
Protein phosphatases and associated proteins [BR:coc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Coch_1624
Messenger RNA biogenesis [BR:coc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Coch_1624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACU93169
JGI: Coch_1624
UniProt: C7M789
Position
1938726..1939706
Genome map
AA seq 326 aa AA seqDB search
MSVKKIAVLTSGGDAPGMNAAIRSVVRTCAYHNIEVVGVYRGYQGMIEGDFEEMNARSVR
DIINRGGTILKSARSKDFKTPEGRKAAYEKLKAAGVDSLVVIGGDGSFTGALLFNKEFGF
PVMGIPGTIDNDIYGTDFTLGYDTALNTVIEAIDKIRDTASSHNRLFFIEVMGRDAGHIA
LNSGVGAGAEEILIPEENIGLKKLLESLEKSRRTGKTSSLVVVAEGDKIGKNVFELKEYV
EQHHPDYDVRVSVLGHMQRGGAPSCFDRVLASRMGVKAVESLLEGKSNYMVGIRNNKMEL
TPLEKAIKGSSKIDTELLRVAEIMAT
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaaaaaaaatagcagtattaacatcaggaggagacgctcctggtatgaacgcc
gccattcgttcagtggtacgtacttgtgcataccacaacatcgaagtggtaggtgtatat
cgtggctatcagggaatgatagaaggcgattttgaagaaatgaacgcacgtagcgttcga
gatattatcaatagaggaggtactatcttgaaatcagcccgctctaaagattttaaaact
cctgaagggcgcaaggcagcttatgaaaaattaaaagctgcaggggtagattctttggta
gtaataggaggtgatggctctttcactggggcactcttgttcaacaaagaatttggtttc
cccgtaatgggaatccctggtactatcgataacgatatctatggtactgattttactttg
ggatatgataccgctctcaacactgtaattgaggctatcgacaagattagagatactgca
agctctcacaaccgcttgtttttcatagaagtaatggggcgtgacgcaggacacatcgcc
ttgaactctggagtaggggcaggtgctgaagaaatcttgattccagaagagaatatagga
cttaaaaagctacttgaatctttggaaaaaagtcgtaggactggtaaaacttccagcttg
gtagtggttgctgaaggcgataaaataggtaaaaacgtattcgaacttaaagaatatgta
gagcaacaccaccccgattacgatgtgcgtgtatcagtattagggcatatgcaacgtgga
ggtgctccttcttgcttcgaccgcgtattggcaagccgtatgggggtaaaagcagtagaa
tcactccttgaagggaaatctaactatatggtaggaatccgcaataataaaatggaactc
actccgcttgaaaaagctatcaaaggtagttctaaaatagatacggaactcctccgtgta
gccgaaataatggcaacttag

DBGET integrated database retrieval system