KEGG   Capnocytophaga ochracea: Coch_1730Help
Entry
Coch_1730         CDS       T00961                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
coc  Capnocytophaga ochracea
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Coch_1730 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Coch_1730 (sucC)
   00640 Propanoate metabolism
    Coch_1730 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Coch_1730 (sucC)
Enzymes [BR:coc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Coch_1730 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2063171..2064364
Genome map
AA seq 397 aa AA seqDB search
MNLHEYQGKEILSSFGVRVQRGIVAHTPTEAVEAAKQLTEATNTQWYVVKAQVHAGGRGK
GGGIKLAKGLDQVEPIASQIIGMQLVTPQTPPSGKKVHQVLIAEDVYYPGESEPKEFYMS
VLLNRAKGKNMIMYSTEGGMDIEAVAEKTPHLIFTEEIDPAVGLLPFQARQIAFNLGVTG
EAQKEMVKFVTALYNAYVSSDASLFEINPVLKTSDNKIMAVDAKVTLDDNALFRHPEYAA
YRDTREENPVEVEAKAVGLNYVALDGNVGCMVNGAGLAMATMDLIKQAGGSPANFLDVGG
TADAKRVEAAFRIILKDPNVKAILINIFGGIVRCDRVAQGVVDAYQNMGDAIKVPIIVRL
QGTNAELAKEILDNSGLAVHSAILFQEAADKVKEVLQ
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacgaataccaaggaaaggaaatcctttcgagttttggggtgcgcgtacaa
cgtggtatcgttgctcacacccccaccgaagccgtagaggcagccaaacaactcaccgaa
gccactaatactcagtggtacgtggtaaaagcacaagtacacgccggagggcgtggaaaa
ggcggtggcattaagttagctaaaggtttagaccaagtagagcctatagcttctcaaatt
ataggtatgcaactcgttacccctcaaacgcccccctcagggaaaaaagtacatcaagtg
ctcatcgccgaagatgtatattatcctggagaaagcgagcctaaagagttctatatgtcg
gtactattgaatcgtgccaaaggtaaaaatatgattatgtattctaccgaaggaggaatg
gatattgaggcagttgccgaaaaaacgccacaccttatcttcaccgaagaaatcgaccct
gccgtagggctcttacctttccaagctcgccagattgctttcaacttaggcgttacgggt
gaggctcaaaaagaaatggtgaagttcgtaacagcactctacaatgcttatgtgtcttct
gatgctagcttgtttgaaatcaaccctgttctaaaaacttctgataataaaataatggca
gtagatgccaaagtaactcttgatgacaatgcacttttccgtcaccctgagtatgcggct
tatcgcgatacacgagaggaaaacccagtagaagtagaagctaaagccgttgggctcaac
tatgttgctctcgatggtaacgtgggctgtatggtaaacggtgccggactcgcaatggct
acgatggacttgattaaacaagcggggggttcacctgctaacttccttgatgtaggaggt
accgccgatgccaaacgcgtagaagctgctttccgtattatcctcaaagaccctaatgta
aaggctatccttatcaatatctttggtggtattgtgcgttgcgaccgtgtagcacaaggg
gtagtagatgcctaccaaaatatgggcgatgctatcaaagtgcctatcatagtgcgcttg
cagggtacgaatgccgagcttgctaaagaaatattagacaattcaggcttagcggttcac
tcagcaatcctcttccaagaagccgccgataaagtaaaagaagtattacaataa

DBGET integrated database retrieval system