KEGG   Capnocytophaga ochracea: Coch_1734Help
Entry
Coch_1734         CDS       T00961                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
coc  Capnocytophaga ochracea
Brite
Enzymes [BR:coc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Coch_1734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_32 Methyltransf_25 Methyltransf_23 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: ACU93279
JGI: Coch_1734
UniProt: C7M819
Position
complement(2068519..2069169)
Genome map
AA seq 216 aa AA seqDB search
MLPLKDTLKHKGLRNQLADLLREKGIKDKRVLEAIRTIPRHLFMDSSFEDHAYQDKAFPI
EEGQTISQPYTVAFQTELLQVSPRQKVLEIGTGSGYQASVLLYLGVQLYTIERQQKLFKQ
TQKLLPKLMNRTVHMYFGDGYKGIPNEAPFDRILVTAGAPYVPKALLAQLAVGGRLVIPI
GEETQTMTLYERISEKEFHKTTHGTFQFVPMLKERN
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgctaccgctgaaagacacattaaaacacaaaggattacggaatcaattagctgattta
ttgagagaaaaaggcataaaggacaagcgtgtattggaggctattcgcacgataccacgc
cacttgtttatggacagcagttttgaagaccacgcttaccaagataaggctttcccgata
gaggaagggcaaactatctctcaaccctataccgtagctttccaaacggaattgctacaa
gtatcacctcgacaaaaagtattggagataggtacgggcagtggctatcaagctagtgta
ctgctatatttaggggtacagctttacactattgagcgacaacagaaactctttaagcaa
acacaaaaactactccccaaactaatgaatcgtactgtgcatatgtactttggcgacggt
tataaagggattcctaacgaagcgccttttgaccgtattttggtaacggcaggcgctcct
tatgtgccgaaagcgttgcttgcacaattggcggtaggaggacgtttagtaattccgata
ggagaagaaactcaaacaatgacgctttacgagcgcatatcggaaaaagaatttcacaag
actacgcacgggacttttcagtttgtaccgatgctaaaagagaggaactga

DBGET integrated database retrieval system