KEGG   Capnocytophaga ochracea: Coch_1741Help
Entry
Coch_1741         CDS       T00961                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
coc  Capnocytophaga ochracea
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Coch_1741
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Coch_1741
  Amino acid metabolism
   00310 Lysine degradation
    Coch_1741
Enzymes [BR:coc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Coch_1741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2076542..2077780
Genome map
AA seq 412 aa AA seqDB search
MLEMKVPSPGESITEVEIARWLVKTGDYVTKDQAVAEVDSDKATLELPAEASGVITLQAE
EGEAVKVGQVVCLIDTKAKAPAGASSAGTSPSQPVKKEAPVAPKTTAPAPSTAPIAPASS
AKQVPSPAARKILAEREIPASAVVGTGKGGRITKEDALKASKPSMGTPTGGVRKEVRTKM
SMLRRKVAERLVSAKNETAMLTTFNEVDMTAIYDLRAKYKDAFKEHHNVSLGFMSFFTLA
VVRALKLFPDVNSMIDGQDKVTYDFCDISIAVSGPKGLMVPVIRNAENLSFRGVEAEVKR
LATRARDGQITVDEMTGGTFTITNGGVFGSMLSTPIINPPQSGILGMHNIVERPIVRNGQ
IVIAPVMYVALSYDHRIIDGRESVGFLVAVKEALENPIDILMNGNPKQALEL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgttggaaatgaaagtcccttcacctggggaatctatcaccgaagtagaaatagcccgt
tggcttgtaaaaacaggtgattatgtaaccaaagaccaagctgttgccgaagtggattcc
gataaggcaaccctcgaacttcccgctgaagccagtggagttattacactgcaagccgaa
gaaggcgaagctgtaaaagtaggacaagtggtatgcttgattgatactaaagcaaaagcg
ccagcaggagcttcatcagcaggtacttcaccatcacaaccagtcaaaaaggaagctcct
gtggcacccaaaactacagctccagcaccttccacagctcctatagcacctgcctcttct
gcaaagcaagttccaagtcctgcagctcgtaaaatattagcagaacgcgagattcctgca
tcagcagtagtgggtacaggcaaaggaggtcgcattaccaaagaagatgcacttaaagcc
tccaaaccttcgatggggactcctacgggtggcgtgcgcaaagaagtgcgtactaagatg
agtatgttgcgccgaaaagtagccgaacgcttggtgagtgctaagaatgaaaccgctatg
ctcactaccttcaatgaggtggatatgacggctatttacgatttgcgtgccaaatataag
gacgctttcaaagagcaccataatgtgagcctcggctttatgtcgttctttactttagcc
gtcgtgcgtgcccttaaactcttccccgatgtcaattcgatgattgacggacaagacaag
gtaacttacgatttctgcgacatctctatagccgtttcaggacctaaaggcttgatggtt
cccgtgattcgcaatgccgagaacctttcgtttagaggtgtggaagccgaagtaaaacgc
ttagccactcgcgctcgcgatggacaaattacggtagatgaaatgactggtggtactttt
acgattactaatgggggcgtgtttggctctatgctttctactcctatcatcaatccgcca
caatcagggattttgggtatgcacaacattgtagagcgtcctatcgtgcgcaacggacag
atagtgattgctcctgtgatgtatgtagctctttcatacgaccaccgtatcatcgatggg
cgtgaatcagtaggatttttagtagctgtaaaagaagctctcgaaaatcctatagatatc
ttgatgaatggcaaccctaaacaagcccttgagctttaa

DBGET integrated database retrieval system