KEGG   Capnocytophaga ochracea: Coch_1741Help
Entry
Coch_1741         CDS       T00961                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
coc  Capnocytophaga ochracea
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Coch_1741
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Coch_1741
  Amino acid metabolism
   00310 Lysine degradation
    Coch_1741
Enzymes [BR:coc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Coch_1741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2076542..2077780
Genome map
AA seq 412 aa AA seqDB search
MLEMKVPSPGESITEVEIARWLVKTGDYVTKDQAVAEVDSDKATLELPAEASGVITLQAE
EGEAVKVGQVVCLIDTKAKAPAGASSAGTSPSQPVKKEAPVAPKTTAPAPSTAPIAPASS
AKQVPSPAARKILAEREIPASAVVGTGKGGRITKEDALKASKPSMGTPTGGVRKEVRTKM
SMLRRKVAERLVSAKNETAMLTTFNEVDMTAIYDLRAKYKDAFKEHHNVSLGFMSFFTLA
VVRALKLFPDVNSMIDGQDKVTYDFCDISIAVSGPKGLMVPVIRNAENLSFRGVEAEVKR
LATRARDGQITVDEMTGGTFTITNGGVFGSMLSTPIINPPQSGILGMHNIVERPIVRNGQ
IVIAPVMYVALSYDHRIIDGRESVGFLVAVKEALENPIDILMNGNPKQALEL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgttggaaatgaaagtcccttcacctggggaatctatcaccgaagtagaaatagcccgt
tggcttgtaaaaacaggtgattatgtaaccaaagaccaagctgttgccgaagtggattcc
gataaggcaaccctcgaacttcccgctgaagccagtggagttattacactgcaagccgaa
gaaggcgaagctgtaaaagtaggacaagtggtatgcttgattgatactaaagcaaaagcg
ccagcaggagcttcatcagcaggtacttcaccatcacaaccagtcaaaaaggaagctcct
gtggcacccaaaactacagctccagcaccttccacagctcctatagcacctgcctcttct
gcaaagcaagttccaagtcctgcagctcgtaaaatattagcagaacgcgagattcctgca
tcagcagtagtgggtacaggcaaaggaggtcgcattaccaaagaagatgcacttaaagcc
tccaaaccttcgatggggactcctacgggtggcgtgcgcaaagaagtgcgtactaagatg
agtatgttgcgccgaaaagtagccgaacgcttggtgagtgctaagaatgaaaccgctatg
ctcactaccttcaatgaggtggatatgacggctatttacgatttgcgtgccaaatataag
gacgctttcaaagagcaccataatgtgagcctcggctttatgtcgttctttactttagcc
gtcgtgcgtgcccttaaactcttccccgatgtcaattcgatgattgacggacaagacaag
gtaacttacgatttctgcgacatctctatagccgtttcaggacctaaaggcttgatggtt
cccgtgattcgcaatgccgagaacctttcgtttagaggtgtggaagccgaagtaaaacgc
ttagccactcgcgctcgcgatggacaaattacggtagatgaaatgactggtggtactttt
acgattactaatgggggcgtgtttggctctatgctttctactcctatcatcaatccgcca
caatcagggattttgggtatgcacaacattgtagagcgtcctatcgtgcgcaacggacag
atagtgattgctcctgtgatgtatgtagctctttcatacgaccaccgtatcatcgatggg
cgtgaatcagtaggatttttagtagctgtaaaagaagctctcgaaaatcctatagatatc
ttgatgaatggcaaccctaaacaagcccttgagctttaa

DBGET integrated database retrieval system