KEGG   Capnocytophaga ochracea: Coch_2044Help
Entry
Coch_2044         CDS       T00961                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
coc  Capnocytophaga ochracea
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:coc00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2448793..2449698)
Genome map
AA seq 301 aa AA seqDB search
MKRTYAGIPTENAMLENSKVMLVTVPYDGTSTWGKGADKGPELFLDASENMELYDIETDT
EPYLNGVFLAGEVSENSSPEAMTQAVYEKTQELLKHEDKLFTLFGGEHSVSIGSIRAVGE
KYEKLTVLQLDAHTDLRPEYHGSTSNHACAVFEANQKHKLVQVGIRSMDVEEKQYLPKGR
VFFAHEIAKNKEWIDDVLDKVSGNVYITIDLDAFDPAIAPSTGTPEPGGLQWYPTLKLLR
KVFKKCNVVAFDIVELMDSQQAKPTAFLAAKLYYKMLAYYFKYRSKKKENKGIEEFFAKK
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaacatatgcaggtattccaacagaaaatgcaatgctggaaaactcaaaagta
atgctggtaacagtaccttatgatggtacgtctacttggggcaaaggagccgataaagga
cctgaattgtttttagatgcctcagaaaatatggagctatacgatattgaaacggatacc
gaaccttatctcaacggagtgtttttagcaggtgaagtaagcgaaaacagttcgccagag
gcaatgacacaagcggtttatgaaaagacccaagaactattgaagcacgaagataagctc
tttactctttttggtggagaacactcagtgtctattggttctatacgtgccgtaggtgaa
aagtatgaaaagcttacagtattgcagcttgatgcccatactgatttgcgccctgagtat
cacggttcgacctctaatcacgcctgtgccgtatttgaagctaaccaaaagcacaaattg
gtacaagtaggtattcgctcgatggatgtagaagaaaagcaatatttaccaaaaggacgt
gtatttttcgctcacgaaatagctaaaaataaagagtggattgatgatgtactcgacaaa
gtatcggggaatgtatatatcacgatagatttagacgccttcgatcctgctatcgcacct
tcaacaggcactcctgaaccaggaggattgcaatggtaccctactcttaaactcttacgt
aaagtgtttaaaaaatgcaatgtggtagcgtttgacattgtagaactaatggatagtcag
caggctaagcctacggctttcttggcagctaaactttattataagatgttagcttattat
tttaaatatagaagtaagaaaaaagagaataaaggtatagaagagttttttgcaaagaag
ggataa

DBGET integrated database retrieval system