KEGG   Capnocytophaga ochracea: Coch_2044Help
Entry
Coch_2044         CDS       T00961                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
coc  Capnocytophaga ochracea
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Coch_2044
Enzymes [BR:coc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Coch_2044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2448793..2449698)
Genome map
AA seq 301 aa AA seqDB search
MKRTYAGIPTENAMLENSKVMLVTVPYDGTSTWGKGADKGPELFLDASENMELYDIETDT
EPYLNGVFLAGEVSENSSPEAMTQAVYEKTQELLKHEDKLFTLFGGEHSVSIGSIRAVGE
KYEKLTVLQLDAHTDLRPEYHGSTSNHACAVFEANQKHKLVQVGIRSMDVEEKQYLPKGR
VFFAHEIAKNKEWIDDVLDKVSGNVYITIDLDAFDPAIAPSTGTPEPGGLQWYPTLKLLR
KVFKKCNVVAFDIVELMDSQQAKPTAFLAAKLYYKMLAYYFKYRSKKKENKGIEEFFAKK
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaacatatgcaggtattccaacagaaaatgcaatgctggaaaactcaaaagta
atgctggtaacagtaccttatgatggtacgtctacttggggcaaaggagccgataaagga
cctgaattgtttttagatgcctcagaaaatatggagctatacgatattgaaacggatacc
gaaccttatctcaacggagtgtttttagcaggtgaagtaagcgaaaacagttcgccagag
gcaatgacacaagcggtttatgaaaagacccaagaactattgaagcacgaagataagctc
tttactctttttggtggagaacactcagtgtctattggttctatacgtgccgtaggtgaa
aagtatgaaaagcttacagtattgcagcttgatgcccatactgatttgcgccctgagtat
cacggttcgacctctaatcacgcctgtgccgtatttgaagctaaccaaaagcacaaattg
gtacaagtaggtattcgctcgatggatgtagaagaaaagcaatatttaccaaaaggacgt
gtatttttcgctcacgaaatagctaaaaataaagagtggattgatgatgtactcgacaaa
gtatcggggaatgtatatatcacgatagatttagacgccttcgatcctgctatcgcacct
tcaacaggcactcctgaaccaggaggattgcaatggtaccctactcttaaactcttacgt
aaagtgtttaaaaaatgcaatgtggtagcgtttgacattgtagaactaatggatagtcag
caggctaagcctacggctttcttggcagctaaactttattataagatgttagcttattat
tttaaatatagaagtaagaaaaaagagaataaaggtatagaagagttttttgcaaagaag
ggataa

  All links  
No link information was found.   
DBGET integrated database retrieval system