KEGG   Capnocytophaga ochracea: Coch_2050Help
Entry
Coch_2050         CDS       T00961                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
coc  Capnocytophaga ochracea
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Coch_2050
Enzymes [BR:coc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Coch_2050
    3.5.1.-  
     Coch_2050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2454769..2455308)
Genome map
AA seq 179 aa AA seqDB search
MKALVIIDVQNDFMPTGTLPVPQGDQIIPFINAEMTQGYDLIVATQDWHPATHKSFASQH
AGKKPFEVIQLGGIDQILWPDHCVQGTFGAELHKDLDIRPIAAIFRKGMNPEVDSYSAFF
DNNKQNNTGLHGFLQDKGITELVFCGLAGDFCVAYSANDAKALGYKVSLFDKGIRSINC
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacttgtaattatagatgttcaaaacgattttatgcctaccggtacattacct
gtaccccaaggcgaccaaataattccctttatcaatgccgaaatgacacaagggtatgac
cttattgttgcaacacaagattggcaccctgctactcataaaagttttgcaagtcagcac
gcaggtaaaaagccttttgaagtaatacagctcggaggtatcgaccaaatactgtggcca
gaccactgtgtgcaaggtactttcggagctgaactgcataaagatttagatattcgtccc
attgcagccatctttcgcaaaggaatgaatcccgaagtagatagctacagtgcttttttt
gataataataaacagaacaacacaggattacacggctttttgcaagacaaaggcattaca
gaactcgtattttgtggcttagcaggtgatttttgtgtagcttatagtgccaatgatgcc
aaagccttaggctataaggtaagtttgttcgacaaaggtataaggtcaatcaattgctaa

DBGET integrated database retrieval system