KEGG   Capnocytophaga ochracea: Coch_2111Help
Entry
Coch_2111         CDS       T00961                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
coc  Capnocytophaga ochracea
Pathway
coc00010  Glycolysis / Gluconeogenesis
coc00260  Glycine, serine and threonine metabolism
coc00680  Methane metabolism
coc01100  Metabolic pathways
coc01110  Biosynthesis of secondary metabolites
coc01120  Microbial metabolism in diverse environments
coc01130  Biosynthesis of antibiotics
coc01200  Carbon metabolism
coc01230  Biosynthesis of amino acids
Module
coc_M00002  Glycolysis, core module involving three-carbon compounds
coc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Coch_2111
  Energy metabolism
   00680 Methane metabolism
    Coch_2111
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Coch_2111
Enzymes [BR:coc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Coch_2111
Membrane trafficking [BR:coc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Coch_2111
Exosome [BR:coc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Coch_2111
  Exosomal proteins of melanoma cells
   Coch_2111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACU93655
JGI: Coch_2111
UniProt: C7M3M9
Position
2530908..2531654
Genome map
AA seq 248 aa AA seqDB search
MYKVVLLRHGQSEWNKLNLFTGWQDVDLTEQGVQEAREAGRVMKEEGFKFDVAYTSVLKR
AIKTLNNALEAMGDLWVPTHKSWRLNEKSYGALQGLNKAETAAKYGEDQVLLWRRSYDVR
PPLIEESDERHPSHDRRYASLTKEEKTAGESLKDCYDRMLPIWFNEIAPDIKAGKSVIIA
AHGNSLRSLVQYLDGLSKEEILKLNIPTGVPLVYELDANLKPIKHYYLGDQEAIAAAINS
VANQGKSK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagtagtacttttacgccacgggcaaagtgaatggaacaagctcaacttattc
acagggtggcaagatgtagatttaacagagcaaggcgtacaagaagcacgtgaagcagga
cgcgtaatgaaagaagaaggcttcaaatttgatgttgcctatacttcagtgctcaaaaga
gctatcaaaaccttgaacaatgctttggaggcaatgggcgacctttgggtgcctacacac
aaaagctggagactcaatgaaaagagttacggggcgctacaaggtttgaacaaagctgaa
actgctgctaaatacggtgaagaccaagtacttttgtggagacgctcttacgatgttcgc
cctccacttattgaagaatcagacgaacgtcacccctcacacgaccgtcgttacgcttca
cttaccaaagaagaaaaaacagcaggcgaaagtttgaaagattgttatgaccgtatgttg
cctatatggtttaacgaaattgcgccagacattaaagcaggcaagagtgtgattatcgca
gcacacggtaacagcttgcgttctttggtacaatacctcgacgggctttcaaaagaagaa
atcttaaagctcaatatcccaacgggagtacctttggtatatgaactcgatgctaatttg
aaacctatcaaacattattatttaggcgaccaagaagctattgcagccgctatcaacagc
gtggcgaatcaaggtaaatcaaaataa

DBGET integrated database retrieval system