KEGG   Capnocytophaga ochracea: Coch_2175Help
Entry
Coch_2175         CDS       T00961                                 

Definition
phospholipase A(2) (EC:3.1.1.4)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
coc  Capnocytophaga ochracea
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:coc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Coch_2175
   00565 Ether lipid metabolism
    Coch_2175
   00590 Arachidonic acid metabolism
    Coch_2175
   00591 Linoleic acid metabolism
    Coch_2175
   00592 alpha-Linolenic acid metabolism
    Coch_2175
Enzymes [BR:coc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Coch_2175
    3.1.1.32  phospholipase A1
     Coch_2175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2590865..2591797)
Genome map
AA seq 310 aa AA seqDB search
MMKYTLFIMFLAIATPIFSQEAVKDTLQELPKTAIKADRRAQLERAISKLWELDREDQRG
TFKFVDYLPMYVMPFRFTDKPTEQPISLNPDRPIPEWRDYQHVEVKFQVSLKAKIMQDAF
GKGDVWVAFTQQSYWQMYNGELSRPFRELNYEPELIFTYPLNLSVGNFKVKMAGLSVNHQ
SNGKEAAHSRSWNRIILLGIFQWNDLMVNSRFWWRFSEKAREDDNPDIENYIGRCELSIA
YPFRKNVFNLRVRNNLNFNHNRGHVELNWVYPLSRDLRILLQASHGYGDSLIDYNYKQTI
VGVGFTFLNL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatacactttatttataatgttcttggctattgcgacacctattttttctcag
gaggcggtgaaagacacattgcaggaacttcctaagacagcaataaaagccgatagaaga
gctcagttggaaagggctatttctaagctatgggagcttgaccgagaagaccagagaggt
acttttaaatttgtggattacttacctatgtacgtaatgcctttccgttttacggataaa
cctacggaacaacctataagtttgaaccccgaccgacctatacccgaatggcgcgactac
cagcacgtggaggtaaaatttcaagtgagcttaaaagctaagattatgcaagatgctttt
gggaagggtgatgtgtgggtagctttcactcagcaatcgtattggcagatgtacaacggt
gagctttcacgtccgtttagggaactgaattacgaacctgaattgatatttacttacccg
ctgaacctctcggtggggaattttaaagtgaaaatggcaggactatccgtaaaccaccaa
tctaatggtaaagaagcggcacattcgcgcagttggaacagaattattttattaggtatt
ttccaatggaatgatttaatggttaatagccgtttctggtggcgtttctcagaaaaagca
agagaagatgacaatcccgatattgagaattatataggacgttgtgaattgagcattgct
taccctttccgtaaaaatgtttttaatttgcgagtgaggaataatttaaattttaatcat
aatcgcgggcacgtagagctgaactgggtatatccgctgagtcgcgacctgcgtattttg
ttgcaagcctctcacggttatggtgattctcttatcgattacaattacaaacaaactatt
gtgggagtagggtttactttcttaaacctttaa

DBGET integrated database retrieval system