KEGG   Corynebacterium pseudotuberculosis 1/06-A: Cp106_0763Help
Entry
Cp106_0763        CDS       T02052                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cod  Corynebacterium pseudotuberculosis 1/06-A
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cod01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cod00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
802525..803598
Genome map
AA seq 357 aa AA seqDB search
MLDLTADPIELTRALVDIESPSHHEEHIADLIEQALKSIPNVEVLRHGNTVVARTHRGLG
SRVILAGHIDTVPTADNVPSTLIDDVLFGCGTVDMKSGMAVYLHAFATLANSQELAQDLT
IVCYEGEEVSSEYNGLGHLQQAHPEWLQGDIALLGEPSGAVIEAGCQGSIRLRITAHGVR
AHSARSWLGTNAMHLLAPVISRIANYEAQEKLVDACLYHEGLNIVHCESGVATNTIPDEA
WMFVNFRFAPDRSLDDAMEHLLETLSLPSGVSYEVDDAVPGARPGLDRPAAVSLLRATGG
KFRAKYGWTDVSRFSEMGIPAVNFGPGDPSYCHKKDEQCPVHMITDVSNTLLDYLRT
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgttggacttgactgctgaccctattgaattaacccgtgcactggtggacattgaaagc
ccctctcaccacgaggagcatattgcggatctgatcgaacaggccttgaagtccattcct
aacgtagaggtactgcgtcatgggaataccgtggttgcgcgcacccatcggggactagga
agcagagttatcctagccgggcacatcgacaccgtacccacagcagataatgttccttcc
actctcatcgatgacgtactttttggctgtggaaccgtcgacatgaaatccggcatggct
gtatatctgcatgcttttgccacccttgctaattcccaagaattagcacaagaccttacg
atcgtttgctatgaaggcgaggaagtctccagcgaatacaacggattaggtcatctgcaa
caagcacaccctgaatggcttcaaggtgatatcgccttactaggagagccatcaggagca
gtcatcgaagcaggatgtcaaggatctattcgtctccggatcacggcgcacggtgtgcga
gcgcattctgcgcgttcgtggctaggaacgaacgccatgcatctcctagcgcctgttatc
tcccgtatcgcgaattatgaggctcaggaaaaacttgtcgacgcctgcctctaccacgag
gggctcaacatcgtgcactgtgaatctggtgtagccactaacacgattcccgatgaagcc
tggatgtttgtaaacttccgttttgccccggaccgcagcctggacgatgcgatggagcat
ttgctggagaccctctcccttcctagcggggtgagctatgaggtggatgacgcggtgccg
ggagcgcggccgggactggaccgtccggctgctgtctctctcctacgcgcaacgggcgga
aaatttcgtgctaaatatggttggactgatgtgtctcgtttttctgaaatgggaattcct
gcagtgaattttggcccgggtgacccctcgtactgccataagaaagacgagcagtgcccg
gttcacatgatcacagacgtctccaacactttgttggactaccttcgtacctag

DBGET integrated database retrieval system