KEGG   Corynebacterium pseudotuberculosis 1/06-A: Cp106_0765Help
Entry
Cp106_0765        CDS       T02052                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cod  Corynebacterium pseudotuberculosis 1/06-A
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cod00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
804391..805248
Genome map
AA seq 285 aa AA seqDB search
MPRSAFLGTEGLATVMAIVNRTPDSFYDHGATHAFDAAIKRAGAVIAAGAGIVDIGGVKA
GPGEFVSISEEIDRVVPVIAAVHEAFPETIISVDTWRAKVAELAVDAGAALINDTWAGYD
PELVEVAGDRRVGYICSHTGGVVPRTRPYRVHYDDVVHAVIDETTRQAEHAVSLGVPEDK
IFIDPTHDFGKNTFHGLELLRRIDEIVATGWPVLMALSNKDFIGETLARNVDKRVPGTLA
ATAWSAERGVAAFRSHQVEETIDVIRMTAAIQGTVSPLKTTRGLA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcctaggagcgccttcctaggcactgaaggcttagctacggtgatggcgatcgtaaat
aggacgcccgattccttttacgatcatggtgcaactcatgcttttgatgccgcaatcaag
cgtgcaggagcagtgattgcagccggtgccgggatcgtggatatcggcggggtcaaagct
gggccaggtgagtttgtttccatttctgaagaaatagaccgtgtggtgccggtgatcgct
gcggtgcacgaggctttccccgagacaatcatttcggtggatacctggcgcgcaaaagtc
gccgagttagccgtcgacgcaggcgccgcgctcatcaacgacacctgggccggctacgat
ccagaactcgtagaagtcgctggagatcgtcgagttggatatatctgctcacacaccggc
ggcgtggtccctaggacaaggccgtatcgcgtgcattacgacgacgtagtgcatgcggtt
atcgatgaaaccacgcggcaagcggagcacgcagtgtccctaggagtaccagaagacaag
atattcatcgatcccactcatgactttggcaaaaacaccttccacggacttgagcttcta
cgccgaatcgacgaaatcgtggccaccggatggcctgtcctcatggctctgtccaataag
gattttattggagaaacgcttgctcggaacgtcgataagcgagtacctggcaccttggca
gcaacagcatggtctgcggagcgaggcgtggcggcgtttcgttcgcatcaagtggaagaa
acaattgacgtgattcggatgactgcggcgattcaaggaacggtttctccgctgaaaaca
actaggggtttggcgtga

DBGET integrated database retrieval system