KEGG   Corynebacterium pseudotuberculosis 1/06-A: Cp106_1281Help
Entry
Cp106_1281        CDS       T02052                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cod  Corynebacterium pseudotuberculosis 1/06-A
Pathway
cod00900  Terpenoid backbone biosynthesis
cod01100  Metabolic pathways
cod01110  Biosynthesis of secondary metabolites
cod01130  Biosynthesis of antibiotics
Module
cod_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cod00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cp106_1281 (dxr)
Enzymes [BR:cod01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Cp106_1281 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Pro-rich_19
Motif
Other DBs
NCBI-ProteinID: AER69345
Position
complement(1395540..1396706)
Genome map
AA seq 388 aa AA seqDB search
MSKRILILGSTGSIGTQALEVIEANPERFQVVGIAAGGRDPRAVIEQARILGLPAHAVAV
ADPQAAHAVSAALGNQILSGEDAATRLVQSIEADTVLNGLVGSLGLSATLATIESGENLA
LANKESLVAGGRFVTSKARPGQIIPVDSEHSAMAQCLRSGARSEVARFVLTASGGPFRGW
TRQQMWDVTPQQAAAHPTWSMGQMNTLNSATLVNKGLELIEATLLFDVPADHIDVTVHPQ
SIVHSMITFSDGATIAQASPPSMKLPISHALDWPARVPDAQPSLDFSSASSWDFMPVDNQ
AFPAIRLAREVALAGGTYPAVYNAANEEAAAAFLAGRIRFPHIVDTVEEIAQNASDFAGE
PHSVDEILAHEKEARRRANLFVDKLAQK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaagcgaattttaattctaggcagcacgggttctatcggtactcaggcccttgaa
gttattgaggcaaatccggagcggtttcaggtcgttggaattgcggcgggcggacgcgat
ccacgcgccgtaatagagcaggcaagaatattgggccttccggctcatgctgttgccgtt
gctgatcctcaagcggcgcatgctgtttctgcagcactcgggaaccagattttgagtggg
gaagatgctgccaccaggcttgttcagagcatagaagctgacactgttttgaatggttta
gtagggtcgctgggactctcagcaacattggccaccattgagagcggggagaatcttgcg
ttggctaataaagagtccttggtagctggcgggagatttgttactagcaaagcgcgtccg
gggcagattatccccgtggattctgagcactcggcgatggctcagtgtttgcgctctggg
gctcgttccgaggttgcgcggtttgtgctaaccgcttcaggtggaccgtttagggggtgg
actagacaacagatgtgggatgtgactcctcagcaagctgcggcgcaccccacgtggtcg
atggggcaaatgaatacactaaactcggcgactttggtaaataaaggactggaattaata
gaagcaacattgcttttcgacgtccccgcagatcacattgacgtcacggtgcatccacag
tcgatagtgcattccatgattactttttcggatggtgcgactatcgctcaggcgtctcct
ccttctatgaaactgccgatttctcatgccttggattggccagcacgcgttccagacgca
cagcctagccttgatttttcttctgcaagttcttgggattttatgcctgtggataatcaa
gctttccctgccattcggcttgcccgtgaagttgcactggcagggggaacctatccggcg
gtatataacgcggctaatgaagaagccgccgctgcttttcttgccggcaggattcggttc
cctcatatcgtggatactgttgaagaaatcgcccagaatgcttctgattttgcgggagag
ccacattccgtagacgagattttggcgcacgagaaagaagcccgacgtcgagcaaatcta
tttgtggataaactagctcagaaatag

DBGET integrated database retrieval system