KEGG   Corynebacterium pseudotuberculosis 1/06-A: Cp106_1315Help
Entry
Cp106_1315        CDS       T02052                                 

Gene name
mutM1
Definition
Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cod  Corynebacterium pseudotuberculosis 1/06-A
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:cod03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1436344..1437126)
Genome map
AA seq 260 aa AA seqDB search
MAVSHSRAARYVVGGPQELEARLRGRVLSSVHRRGKFLWFVLDDSCALMVHLGMSGQMLI
KQADASLHPHTRIRCSLSSGSEQSELWFVDQRTFGYWRIAELVYSHNRLVPKPMAHIAAD
LLEPAQDLMATARLIKTKHLEIKRLLLNQEIVAGIGNIYADEMLWSAQIHPRQKAHRLSL
RAIHSLLNEGQRVMHNALLQGGTSFDSLYVNVNGESGYFDVSLQAYGQEGMPCTRCGTAL
VREKFSNRSSHFCPRCQRLQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtctcacattctcgtgctgcacgctatgtagtaggcggccctcaggagcttgag
gcgcggctacgcggacgagtgctttcctcggtgcatcggcgcggaaagtttttgtggttt
gttttggatgactcttgtgcacttatggtgcatctgggtatgagtgggcagatgcttatt
aagcaagctgatgcctcattgcatcctcatacccggattcgctgttctcttagttctgga
agcgaacagagcgaattatggtttgtggatcagcgtacgtttggctattggagaatcgcc
gaattggtctattcccataatcgattagttcctaagccaatggcccacatagcagccgat
ctattggaacccgcgcaagatcttatggcgacagcgcgactgattaaaactaaacattta
gagattaaaagactgcttcttaatcaagagattgttgcgggaatcggtaatatatacgca
gatgagatgctgtggtctgcgcaaatacaccctaggcagaaggcgcacaggctttcatta
cgtgcgattcactcgctcttaaatgaaggacaaagagtgatgcataatgctctgctgcaa
ggaggaacaagttttgattcgctgtatgtcaatgttaatggcgaatctggctattttgat
gtttctttgcaggcttatggccaagaaggaatgccttgcacgcgatgcggtacagcgttg
gtgcgggaaaagttttccaatcgttcaagtcacttttgtccacgatgccagcggctgcaa
tag

DBGET integrated database retrieval system